KEGG   Psychrobacter sp. PRwf-1: PsycPRwf_1873Help
Entry
PsycPRwf_1873     CDS       T00541                                 

Definition
(GenBank) malate dehydrogenase (NAD)
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
prw  Psychrobacter sp. PRwf-1
Pathway
prw00020  Citrate cycle (TCA cycle)
prw00270  Cysteine and methionine metabolism
prw00620  Pyruvate metabolism
prw00630  Glyoxylate and dicarboxylate metabolism
prw00680  Methane metabolism
prw01100  Metabolic pathways
prw01110  Biosynthesis of secondary metabolites
prw01120  Microbial metabolism in diverse environments
prw01130  Biosynthesis of antibiotics
prw01200  Carbon metabolism
Module
prw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
prw_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
prw_M00012  Glyoxylate cycle
prw_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:prw00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PsycPRwf_1873
   00620 Pyruvate metabolism
    PsycPRwf_1873
   00630 Glyoxylate and dicarboxylate metabolism
    PsycPRwf_1873
  Energy metabolism
   00680 Methane metabolism
    PsycPRwf_1873
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    PsycPRwf_1873
Enzymes [BR:prw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     PsycPRwf_1873
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_N Ldh_1_C Glyco_hydro_3_C
Motif
Other DBs
NCBI-ProteinID: ABQ94813
JGI: PsycPRwf1873
UniProt: A5WGM2
LinkDB All DBs
Position
complement(2329112..2330095)
Genome map
AA seq 327 aa AA seqDB search
MKQPVRVAVTGAAGNISYAMLFRIASGEMLGKDQPVILQLLEITPALDALKGVVMELEDC
AFPLLAGVVQTDDATVAFKDADYALLVGARPRGPGMERKDLLEANAAIFSAQGKALNEVA
SRDVKVLVVGNPANTNALIAQRNAPDLDPRNFTAMTRLDHNRGMAQLAEETNSTVNDVKK
MIIWGNHSSTQYPDLTECTVNGKPALEQVDRDWYENSYIPSVQKRGAAIIEARGASSAAS
AANAAIAHMRTWALGTDENDWVSMGVYSQGEYGIAKGLIYSFPCTCSNGDWKIVEGLDTS
SDFSQEKMKATEQELSEERDAVEHLLP
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacctgttcgcgttgccgttactggtgctgctggtaatattagctatgctatg
ctgtttcgtattgcttcaggcgaaatgctaggtaaagatcagcctgttattctacagctt
ttagaaatcacaccagcacttgacgccctaaaaggggttgttatggagcttgaagattgt
gctttcccactgttagcgggcgtggtacaaactgacgatgctactgttgcatttaaagac
gcagactacgctttattggtaggtgcacgtcctcgtggtccaggcatggagcgtaaagac
ttacttgaagccaacgctgctatcttctcagctcaaggtaaagctttaaacgaagtagcc
agccgtgatgttaaagtattggttgtgggtaacccagcgaacaccaacgctttaattgct
cagcgtaacgcaccagatctagacccacgtaacttcactgctatgactcgtcttgaccac
aaccgtggtatggcgcagcttgctgaagagaccaacagcaccgtaaatgatgttaagaaa
atgatcatttggggtaaccactcttcaactcagtacccagatctaactgagtgtacagtg
aacggtaagccagctttagaacaagtagaccgtgactggtacgaaaacagctatatccca
agcgttcaaaaacgtggcgcagccatcattgaagcgcgtggtgcttcatcagctgcttct
gctgctaacgctgccattgctcacatgcgcacttgggcactaggtactgatgagaacgat
tgggtatctatgggtgtttactcacaaggtgagtacggcatcgctaaaggtctaatctac
tcattcccatgtacttgcagcaatggcgattggaaaattgttgaaggtctagacacctca
tctgacttctcacaagaaaaaatgaaagccactgagcaagagcttagcgaagagcgtgac
gcagtagagcacttacttccatag

DBGET integrated database retrieval system