KEGG   Pseudomonas stutzeri A1501: PST_0039Help
Entry
PST_0039          CDS       T00511                                 

Gene name
katE
Definition
(GenBank) catalase
  KO
K03781  
catalase [EC:1.11.1.6]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:psa00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PST_0039 (katE)
  Amino acid metabolism
   00380 Tryptophan metabolism
    PST_0039 (katE)
Enzymes [BR:psa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     PST_0039 (katE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
44325..46460
Genome map
AA seq 711 aa AA seqDB search
MTDKTPQQSELAGTDTVDRANHNAKLDQLEAFRSDATGEALRTNQGVKIADNQNTLKAGG
RGPSLLEDFIMREKITHFDHERIPERIVHARGAAAHGVFVSYADHSWLTKASFLAAEGKE
TPVFVRFSTVQGSRGSADTVRDVRGFATKFYTDEGNFDLVGNNMPVFFIQDAIKFPDFVH
AVKPEPHNEIPQAQSAHDTFWDFVSLTPESAHMVLWTMSDRALPRSYRAMEGFGVHTFRL
INAEGVSRFVKFHWKPVAGAFSLVWDETLKIAGKDPDFNRRDMWESIEMGDYFEWELGVQ
VVEEADEHKFDFDLLDPTKIIPEELVPVQKLGKMTLNRNPDNFFAETEQAAFHIGHIVPG
IDFTNDPLLQGRLFSYTDTQLLRLGGPNFHEIPINRPLCPFHNNQRDAFHRQTIHKGRAN
YEPNSIDNGWPKETPPAAQGGGFESYPERVEGHKIRNRSESFGDHFSQATLFWNSMSGPE
KEHIIGAYTFELGKVERVFIRERQVNEILANIDLELARRVAENLGLPAPAAPTVAAKVPT
PQSSPALSLMNHAPGNIKSRKIAILVANGVDGAAIDAFKAKLAEQGALAKIIGPSPAPVK
TADGKMLPVDAAMDGMPSVMFDAVFVPGGADAAAAMAKSGEAKHYLLEAYKHLKPIVVLG
AARPLLASLNLTADSGLLEGDDVDAVFGNFAQALGQHRVWAREAAAEAIPA
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaagaccccgcaacagagcgagctggccggtaccgacactgtcgaccgcgcc
aatcacaacgccaagctcgaccagctggaagcgtttcgcagcgacgccaccggcgaggcg
ctgcgcaccaatcagggcgtgaagatcgccgacaaccagaacaccctcaaggccggcggc
cgtgggccctcgctgctcgaagatttcatcatgcgcgagaagatcacccacttcgaccat
gagcgcatccccgagcgcatcgtgcatgcccgcggtgccgcggcgcacggcgtgttcgtc
agctacgccgaccacagctggctgaccaaggcctcgttcctcgccgccgaaggcaaggag
acgccggtgttcgtgcgcttctccaccgtgcagggctcgcgcggctcggcggacaccgtg
cgcgacgtgcgtggcttcgccaccaagttctacaccgacgagggcaacttcgacctggtc
ggcaacaacatgccggtgttcttcatccaggacgccatcaagtttccggacttcgtccac
gcggtcaaacccgagccgcacaacgagatcccgcaggcgcaatcggcccacgataccttc
tgggatttcgtctcgctgacgcctgagtccgcacacatggtgctctggaccatgtccgac
cgcgccctgccgcgcagctaccgggcgatggaaggcttcggcgtgcacaccttccgcctg
atcaatgccgagggcgtcagccgcttcgtcaaattccactggaagccggtggccggcgcc
ttctcgctggtctgggacgagacgctgaagatcgccggcaaggacccggacttcaaccgc
cgcgacatgtgggagtccatcgagatgggcgactacttcgagtgggagctgggcgtgcag
gtggtcgaggaggccgacgagcacaagttcgacttcgacctgctggacccgaccaaaatc
atccccgaggagctggtgccggtgcagaagctcggcaagatgaccctcaaccgcaacccg
gacaacttcttcgccgagaccgagcaggccgccttccacattggccatatcgtgccgggc
atcgacttcaccaacgacccgctgctgcagggccggctgttctcctacaccgacacccag
ctgctgcgtctcggtgggccgaacttccacgaaattccgatcaaccgtccgctgtgtccg
tttcacaacaaccagcgcgacgccttccatcgccagacgatccacaagggccgcgccaac
tacgagcccaactccatcgacaacggctggcccaaggaaaccccgccggcagctcagggc
ggcggtttcgagagctatccggagcgggtcgaggggcacaagatccgcaaccgcagcgaa
tccttcggcgaccacttctcccaggccacgctgttctggaacagcatgagcggcccggag
aaggagcacatcatcggtgcctataccttcgagctgggcaaggtcgagcgggtgttcatc
cgtgagcgtcaggtcaacgagatcctcgccaacatcgacctggagctggcccgccgcgtg
gccgagaacctcggcctgccggcacccgctgcgccgaccgtagcggcgaaggtaccgacc
ccgcaaagctcgccggccctgagtttgatgaaccatgcaccgggcaatatcaagtcgcgc
aagatcgccattctggtggccaacggcgtcgatggtgcggcgatcgatgcattcaaggcc
aagctggccgagcagggcgcgttggccaagatcatcggtccctcgccggcgccggtgaag
acggcggacggcaagatgctgccggtcgatgccgcgatggacggcatgccctcggtgatg
ttcgacgccgtgttcgtccccggcggtgccgatgcggcggcggccatggccaagtccggc
gaagccaagcactacctgctggaggcctacaagcacctgaaacccatcgtggtgctcggt
gcggcacggccgctgctggcatcgctgaacctcactgccgacagcgggctgctggagggc
gatgacgtcgatgcggtattcggcaacttcgctcaggcgctcggtcagcaccgggtgtgg
gcgcgtgaggccgcggcggaggcgatcccggcgtaa

DBGET integrated database retrieval system