KEGG   Pseudomonas stutzeri A1501: PST_4093Help
Entry
PST_4093          CDS       T00511                                 

Gene name
nasE
Definition
(GenBank) nitrate ABC transporter permease protein
  KO
K15577  
nitrate/nitrite transport system permease protein
Organism
psa  Pseudomonas stutzeri A1501
Pathway
Nitrogen metabolism
ABC transporters
Module
Nitrate/nitrite transport system
Brite
KEGG Orthology (KO) [BR:psa00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    PST_4093 (nasE)
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    PST_4093 (nasE)
Transporters [BR:psa02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    PST_4093 (nasE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4447586..4448377
Genome map
AA seq 263 aa AA seqDB search
MQRSGRYAVQQLLPPLVILLVLGVIWEMLCSGADAALPPPSQVIAETWELIVDPFYDNGG
NDVGLAWQLLASLERVAVGYLLAVVAGVGLGVLIGQSDWAMRGLDPIFQVLRTVPPLAWL
PLSLAGFQDSHPSALFVIFITAIWPIIINTAVGIRNIPQDYRNVAQVLQLNGFEYFKTIM
LPAAAPYIFTGLRIGVGLSWLAIIAAEMLIGGVGIGFFIWDAWNASRISDIILALVYIGV
VGFVLDRLVAFVGQRITRGIPAN
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgtagcggccgctacgcggtgcagcagctgttgccgcccctggtcatcctgctg
gtgctcggggtgatctgggagatgctctgctccggtgccgatgccgcgctgccaccgcct
tcgcaggtgatcgcggaaacctgggagctgatcgtcgatccgttctacgacaacggcggc
aatgacgtgggcctggcctggcaactgctggcgagcctcgaacgggtggcggtgggttat
ctgctggcggtggtcgccggggtcggcctcggcgtgctgatcggccagtcggactgggcc
atgcgcggcctcgatccgatcttccaggtgctgcggaccgtgccgccactggcctggctg
ccgctgtcgctggcgggctttcaggacagtcatccctcggcgctgttcgtcattttcatc
accgcgatctggccgatcatcatcaataccgcagtgggcatccgcaacatcccgcaggac
taccgcaacgtcgcccaggtgctgcagctcaatggcttcgaatatttcaagaccatcatg
ctgccggccgccgcgccctacatcttcaccggcctgcgcatcggcgtcggcctgtcgtgg
ctggcgatcatcgccgcggagatgctcatcggcggcgtcggcatcggcttcttcatctgg
gatgcgtggaacgcctcgcgcatcagcgacatcatcctcgcgctcgtctacatcggcgtg
gtcggcttcgtgctcgatcgcctggtggccttcgtcggccagcgcatcactcgcggcatt
ccggccaactga

DBGET integrated database retrieval system