KEGG   Proteiniphilum saccharofermentans: PSM36_3106Help
Entry
PSM36_3106        CDS       T04672                                 

Gene name
nanH
Definition
(GenBank) Exo-alpha-sialidase
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
psac  Proteiniphilum saccharofermentans
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:psac00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    PSM36_3106 (nanH)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    PSM36_3106 (nanH)
Enzymes [BR:psac01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     PSM36_3106 (nanH)
Bacterial toxins [BR:psac02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   PSM36_3106 (nanH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
I:3909791..3911419
Genome map
AA seq 542 aa AA seqDB search
MKRIILSFLLACFIFTIQATDTIYIKQTKIPVLIDRLDNVLFYVRIDARNSKTLDEIKLR
FAEDTHPDEIASVKLYYGGTEAPERLGNIHYAPVQYISSHNAQGKTREAIPSYSIKVNEQ
QSPSGEVVFKPEYKLFPGINYFWVSLQMKPNTSLLSTVGVDLVSAKLDGKNAPVTSQDKP
AAHRMGIGVRHAGDDGAAAYRIPGLATSNKGSLLAVYDVRYNNSVDLQEYIDVGLSRSTD
KGQSWEEMRLPLSFGEYGGLPKAQNGVGDPAILVDTKSGTIWIIALWTHGMGNRRAWHNS
QAGMDINETGQLVLTKSTDDGKTWSDPINITQQVKDPSWRLLLQGPGRGITMQDGTLVFP
IQFIDSTSVPFAGIMYSKDSGETWKIHNPARSNTTEAQVAETAPGVLMLNMRDNRGGSRA
VSTTGDLGLTWTEHPSSRKVLQEPVCMASLLQVDAKDNVLNRDILLFSNPNSTKERNKIT
IKASLDGGISFPEEYQLLLDEDHGWGYSCLTMIDKETIGIIYESSVAHMTFQAIKLTDII
RK
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaattattttaagtttcctgcttgcctgtttcattttcaccatccaggccaca
gatacgatatatataaaacaaacaaaaattcccgttttaatagacaggttggataatgta
ttgttttacgtccggatagatgcccgaaattcaaaaacgctggatgagatcaaactcagg
tttgccgaagatactcatccggacgaaatagcatccgtaaaattgtattacggtggtact
gaagcgccggaacggctgggaaatatccactatgcgccggtacagtatatttcaagtcat
aacgcgcaggggaaaactcgtgaggcaatcccatcctattccattaaagtaaacgagcag
caatcaccgtccggcgaagtggtgtttaaaccggaatataaactgtttccgggcattaac
tatttctgggtgagcttgcagatgaaacctaatacttcgcttctttctacggttggggta
gatcttgtttcggctaaactcgacgggaagaatgcacctgtaacaagccaggataaaccg
gcagcacatcgcatgggaatcggggtacgccatgccggcgacgatggcgcagccgcttat
cgtatcccgggattagccacgagcaataaaggctcattgctggcagtgtatgatgtccgc
tataataacagtgttgatctgcaggaatatatagatgtaggattaagtagaagtaccgat
aagggacagtcctgggaagagatgcgtcttcctttgagcttcggcgaatatgggggatta
ccgaaagcacagaatggcgtaggcgatcccgcgatattagtggatacaaaaagcggcaca
atctggatcattgcactatggacacacggcatggggaacaggcgtgcatggcacaactcc
caggccggaatggatataaatgaaaccggacaacttgtgcttacaaaaagtactgatgac
ggtaaaacctggtctgatcctatcaatatcacacaacaggtgaaagatccgtcatggagg
cttttactacaaggccccggaagaggtatcaccatgcaggacgggacgctggtctttccg
atacaatttatcgactccacttccgttccctttgccggcatcatgtatagcaaagacagc
ggtgaaacatggaaaatccataacccggcacgctcgaacacgacggaagcacaagtagct
gaaacagctccgggagtacttatgctgaatatgcgggataaccggggtggtagccgtgcc
gtttcaacaaccggagacctgggattgacatggacggaacatccttcatcccgtaaagtg
ctacaggagccagtctgtatggccagccttttacaggtagatgccaaagataatgtactg
aacagggatatcttattgttctccaacccaaattctaccaaggaacggaataagataacg
attaaagccagcctggatggtggcatctcttttcctgaagagtatcagttactgctcgat
gaggatcacggatggggatattcgtgcctgacgatgatcgacaaagagaccattggtatt
atatacgaaagcagtgtggcccatatgacattccaggccataaaactgactgatattatc
aggaaatag

DBGET integrated database retrieval system