KEGG   Proteiniphilum saccharofermentans: PSM36_3309Help
Entry
PSM36_3309        CDS       T04672                                 

Definition
(GenBank) Beta-galactosidase
  KO
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
psac  Proteiniphilum saccharofermentans
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psac00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PSM36_3309
  Lipid metabolism
   00600 Sphingolipid metabolism
    PSM36_3309
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    PSM36_3309
Enzymes [BR:psac01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     PSM36_3309
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
I:complement(4154710..4157229)
Genome map
AA seq 839 aa AA seqDB search
MKNAIAILLLLGVVFTGFNACRNVDRNPRKTESFNDGWRFYLGDLSDASDPVFDDNGWRE
LELPHDWAIEGDFSEDHPSGSGGGALPGGIGWYRKSFFLDQSYEGKKIFVDFDGVYMNSD
VWINGIHLGHRPFGYISFRYDLTPHLKFDTENVIAVRVDNSEQPNSRWYSGCGIYRNVWL
TSVDPVYVDLWGVYVTTPEITEDNAVVNVKTTVKNEMPQEVNLKTETSIVDGSGKQVASA
SVSGTLAAGSSKEIEQDLSVREPVLWALENPCLYEVVTRIFVDDKQTDEYVTPLGIRYFT
FDAEKGFFLNGESTKIKGVCLHHDLGCLGAAVNTRAIERQLEILKEMGVNGIRTAHNPPA
PELLRLCDRMGFIVMDETFDMWRKRKTTYDYSRYFNEWHERDLTDHILRDRNHPSVFMWS
IGNEVLEQWTHAEADTLDIQQANLLLNLKRDETALAGTDGETMSVNALLTKKLADIVKSL
DPTRPVTTGNNETNPANHLFRSGALDLIGFNYHGYDYKNVPENFPGKPFIAAETTSGLMT
RGYYRMPSDSMYIWPVRWDIPFTDPSYACSSYDNCHVPWGCTHEQAWNDVKNSDFISGMY
IWTGFDYLGEPTPFWFPARSSYFGIVDLAGFPKDVYYMYQSEWTDKEVLHVFPHWNWQPG
ETVDVWAYYSKADEVELFLNGVSQGIKRKEGGKHHVFWRLAYETGTIKVISRKNGKEVLS
KEIKTAGEPSQIRLTPDRRVIRGNGQDLSFITVEVLDKEGTICPNAENLIRFNLSGNGKV
VGVDNGNPTSMERFKASERKAFYGKCMVVVKSEKREGVIHLAAESDGLIKDAIEIKVTK
NT seq 2520 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgctattgccatactattattgctcggcgttgtttttaccggattcaatgcc
tgccggaatgtcgaccggaaccctcgcaaaacagaaagtttcaacgatggttggcgtttt
tatcttggggatctttccgatgcaagcgatcctgtattcgacgataacggttggagggaa
ctggagttgccccacgattgggcgattgaaggtgatttcagtgaggatcacccttccgga
agcgggggtggagccctgcccggcggaatcggttggtaccggaaatcgtttttcctcgat
caatcctatgaaggaaaaaagatatttgttgatttcgacggagtctatatgaattccgat
gtatggatcaacggcatccatctcgggcatcggccgtttggctatatatcgttccggtat
gacctgactccccatttgaaatttgatacggaaaatgtcatagcggtacgggtggacaac
agtgagcaacccaattcccgttggtattcgggatgcggtatttataggaatgtatggctg
acaagtgtcgatccggtgtatgttgatctgtggggagtatatgtaacgacgccggagatt
acagaggataatgccgttgtgaatgtaaaaacaaccgttaaaaacgaaatgccacaagaa
gtgaatctaaaaactgagacatctattgtagacggttcgggcaaacaggtcgcttcggct
tcggtctccggcacactggctgccggctcttccaaagagatcgaacaggatctctccgtg
cgggagccggtattgtgggcacttgaaaatccctgtttgtacgaggtagtcacccgtatt
ttcgtggacgacaaacagaccgatgaatatgtaaccccgctcgggatccgctatttcacg
ttcgacgcggaaaaaggattcttccttaacggtgaatcgacgaagataaaaggagtctgc
ctgcatcacgatttaggatgcctcggtgcggccgtcaacacaagggccattgaacggcag
ctcgagatactcaaagagatgggtgtgaatggtattcgtactgcgcataatcctcccgca
ccggaactgctccggctatgcgacaggatgggattcattgtcatggatgaaaccttcgac
atgtggcgtaaacgaaagaccacatacgattactcacgctattttaacgagtggcacgaa
agagacctcacagaccatattctccgtgaccgtaatcatccctcggtatttatgtggagc
atcgggaatgaagtccttgaacaatggacccacgccgaagccgatacactcgatatccag
caggctaatctcctgttgaaccttaaacgcgatgaaacggcactggcggggacagatggg
gagacgatgagtgtgaatgctctcctgacaaaaaaactggcggatatcgtaaaaagtttg
gatccgacccgacccgtgacaaccggaaacaatgaaaccaatccggccaatcacctcttc
agatcgggagcgctcgacctgatcggattcaattatcatggatatgactataagaacgtg
ccggagaacttcccgggaaaaccgtttattgcagcggaaaccacttcaggactgatgacc
cgcggttattaccggatgccaagcgactccatgtatatctggccggtacgttgggatatc
ccgtttaccgatccttcctatgcctgctcttcctacgataattgccacgtcccttgggga
tgtacgcacgagcaggcatggaacgacgtgaaaaacagtgacttcattagtggaatgtat
atctggacaggttttgactatctcggcgaaccgacccctttctggtttcctgcacggagt
tcttattttggcattgtggatctggcggggttcccgaaagatgtctattacatgtatcaa
tcggaatggaccgataaagaggtattgcatgtttttccgcactggaactggcaaccggga
gaaactgtggacgtctgggcctattacagcaaggcagatgaagtggagttatttttgaac
ggcgtctctcagggcatcaaaagaaaagagggcggcaagcaccatgtcttttggcgactg
gcttatgaaaccggcacaataaaagtgatttccaggaaaaatggaaaagaggtattatcg
aaagaaataaaaacggccggagaaccgtcgcagatccgtttaacgcctgacaggcgtgtg
atcaggggcaacggacaagatcttagttttattacagtggaagttttggacaaagagggc
actatctgccctaatgcagagaacctgatccgtttcaacctgtcgggtaacggaaaggtc
gtcggtgtggacaatgggaacccgacaagtatggaacggttcaaagcatcggaacggaaa
gcattttatgggaaatgcatggttgttgtgaaaagtgaaaagagagaaggagttattcat
ctggcggcagagtcggatggattgataaaagatgccattgaaataaaggtgacgaagtaa

DBGET integrated database retrieval system