KEGG   Pseudomonas stutzeri CCUG 29243: A458_00805Help
Entry
A458_00805        CDS       T02168                                 

Definition
(GenBank) nitrate ABC transporter permease
  KO
K15577  
nitrate/nitrite transport system permease protein
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
Nitrogen metabolism
ABC transporters
Module
Nitrate/nitrite transport system
Brite
KEGG Orthology (KO) [BR:psc00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    A458_00805
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    A458_00805
Transporters [BR:psc02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    A458_00805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(164521..165390)
Genome map
AA seq 289 aa AA seqDB search
MNANVKLQPATAEPVSIVRPSRLATLARRSGRYAVQQLVPPLVILLLLGLIWEMLCSGAD
AALPPPSQVVAETWELIVDPFYDNGGNDVGLAWQLLASLERVAIGYLLAVVAGVGLGVLI
GHSDWAMRGLDPIFQVLRTVPPLAWLPLSLAGFQDSHPSALFVIFITAIWPIIINTAVGI
RNIPQDYRNVAQVLQLNGFEYFKTIMLPAAAPYIFTGLRIGVGLSWLAIIAAEMLIGGVG
IGFFIWDAWNASRISDIILALVYIGVVGFVLDRLVAFVGQRITRGIPAN
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccaacgtcaaactgcagcccgccaccgccgagccggtatccatcgtccgccct
tcccggctcgccacactggctcggcgcagcggccgctacgcggtgcagcagctggtgcca
ccgctggtgatcctgctgctgctcggcttgatctgggagatgctctgctctggcgcggac
gccgcgctgccgccgccgtcgcaggtggttgcggaaacctgggagctgatcgtcgatccg
ttctacgacaacggcggcaatgacgtgggcctggcctggcagctgctggcgagcctcgaa
cgggtggcgatcggctatctgctggcggtggtcgccggggtcggcctcggcgtgctgatc
ggccattcggactgggccatgcgcggcctcgatccgatcttccaggtgctgcgcaccgtg
ccgccgctggcctggctgccgctgtcgctggcgggcttccaggacagccatccctcggcg
ctgttcgtcatcttcatcaccgcgatctggccgatcatcatcaataccgcagtgggcatc
cgcaacatcccgcaggactaccgcaacgtcgcccaggtgctgcagctcaacggtttcgag
tacttcaagaccatcatgctgccggccgccgcgccctacatcttcaccggcctgcgtatc
ggcgtcggcctgtcgtggctggcgatcatcgctgcggaaatgctcatcggcggcgtcggc
atcggcttcttcatctgggatgcgtggaacgcctcgcgcatcagcgacatcatcctcgcg
ctcgtctacatcggcgtggtcggcttcgtgctcgatcgcctggtggccttcgtcggccag
cgcatcacccgcggcattccggccaattga

DBGET integrated database retrieval system