KEGG   Phialocephala scopiformis: LY89DRAFT_600648Help
Entry
LY89DRAFT_600648  CDS       T04865                                 

Definition
(RefSeq) SET domain-containing protein
  KO
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
psco  Phialocephala scopiformis
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:psco00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    LY89DRAFT_600648
Enzymes [BR:psco01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     LY89DRAFT_600648
Chromosome [BR:psco03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     LY89DRAFT_600648
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    LY89DRAFT_600648
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 311 aa AA seqDB search
MAAAHLVCHENGLEKYAEEEKRCHYCQFRRFSTHYEFPISINNDVDNEGLPESFQFVNKV
VPSADVPLIAEEFVSSCECVADHCVTQNCTCLSDIDASRLPGLKKNAYHATGQLRSAYLN
GHYPIYECGDKCKCGQNCPNRVVQRGRTVCLQIFKTDDGRGWGVKTLSPIIRGYFVDCYF
GELLTPDEAQARRDQASSVQQKDVYLFALDKFTDIRSPDPRLHAPYEIDGEFISGPTRFI
NHSCDPNLRIFAVVKNSADQPFHSLAFFALENIAPNTELTFDYLDGITGDGDDKEKTKCL
CGAENCRGYLF
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggcagctgctcacctagtatgtcacgagaatggtcttgaaaagtacgccgaagaggag
aagagatgccattactgtcaattccgaagattctctactcactacgaatttccgatctcc
atcaacaacgacgttgacaacgaaggactccccgaatcattccagttcgttaacaaggtt
gtgccaagcgccgatgtaccactcatagctgaggagttcgtcagtagctgtgagtgtgtt
gctgatcattgtgtgacgcaaaattgcacttgcttgagcgacatcgatgccagcaggctt
cctggattgaagaagaacgcgtatcatgctaccggtcaattgaggagcgcctatctcaat
ggacactatccgatctacgagtgcggtgacaagtgcaagtgtggccagaattgtccaaat
cgagttgttcagagaggtcgcacggtttgccttcagatcttcaagactgatgatggacgc
ggatggggtgtaaagactttgagcccaatcatccggggttattttgtcgactgctacttc
ggagagttacttactcctgatgaagctcaagctcgtcgtgaccaagccagctcggtccaa
cagaaggacgtgtatctgttcgcactggacaaattcacggacattcgcagtccagatcca
cgtctccacgctccctacgagattgatggagagtttatatccggtccgacacgattcatc
aatcactcctgtgatcccaaccttcgcatcttcgctgtggtcaagaattcggctgatcaa
ccattccatagcctggcattcttcgctctcgagaatattgcacccaatacggagcttact
ttcgactacttggatgggatcaccggtgacggcgatgataaggagaagacaaaatgtctc
tgtggtgccgagaactgccgtggatatctattttga

DBGET integrated database retrieval system