KEGG   Phialocephala scopiformis: LY89DRAFT_691442Help
Entry
LY89DRAFT_691442  CDS       T04865                                 

Definition
(RefSeq) histone H3-K4 methyltransferase Set1
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
psco  Phialocephala scopiformis
Pathway
psco00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:psco00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    LY89DRAFT_691442
Enzymes [BR:psco01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     LY89DRAFT_691442
Chromosome [BR:psco03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     LY89DRAFT_691442
   HMT complexes
    COMPASS/SET1 complex
     LY89DRAFT_691442
    COMPASS/SET1 complex (yeast)
     LY89DRAFT_691442
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: N-SET SET SET_assoc DUF4406
Motif
Other DBs
NCBI-GeneID: 28826050
NCBI-ProteinID: XP_018062046
JGI: 691442
UniProt: A0A132B5S3
LinkDB All DBs
Position
Unknown
AA seq 1270 aa AA seqDB search
MSRASGASFAQFFPSAPRAAKDKAKEREKVKSQGLDSPSIRPVADSKVSLSFPRADDAAS
SRFGAEIKPPPVNGVAATTEDSDFLQGDLLNGVGSASSHTSTVSSGFSAPAQQPNMSTLG
GPRNVSSLTPLTNIESSPIPATSPQHKSGTYTTTPNELTNAIAVGTNFTLSAQPPVEAEA
PHIPTDSRVYARDPNKGVKGVKCTYDPLLDKTASKKAKAIYKEFGLEDDAPPADPRLSKP
GGKLDYINTDFHHAKSRLRQTPYLLRPYPYDPKTSLGPGPPTQVVVTGFDPLHNFANVAA
IFSSFGEVAESSNKLHPETGSCLGFATFRYRDSKVMKGVRFVSAIEAAKTAVRKGVGLRV
GTQNVKVEFDPEGNKSRRMMENLLKRPQAAQTSQMAKAAPAGAKPAEKTSGPPPTAPKGP
AASRPTYRPPISTAFQLTKPKPPRYIEGVEPISAQLLHQPFLFVANDSVPVMPTTPPHMF
KRCKHFQAEEVKMDQAGYYITFPTTELGRENCSRCYRGLNQTLMFNYTMIMAMYPWGSSR
PAELRYIPFHSTRRRSASLPRQIEDKEKKDAEERQREDEADLEDEKRERAKNFDPSREAI
EVIRKELKDQLVRNIRTKIAAPILHNFMDPSNHVAKRRKLNISDPKDAKLPLIHEDDDRE
ETPVGTPNSRVDGERRPMSTARLNVSSLPRIRKAKGGKKLNIGFRDPFGRARPEARKPVI
RPLNHRFITSDDEDTDDDTESRSRVRDTEEPDSRPRSRMSSEESTDDAEAFRTKDDVASV
DTRDDDSMSEANFVVGEPTRPKKRKLDLQVEAALKRQKKTDEELFGVAQDKIEEEFPLSA
STVDEDALMQDIDAIVKTESEAEAAFAKGKKKVATKKAKKSKRQIFEEREALKRQSEGIY
MEEALRQQSEAIEEEEEDVIIQSAPVETTVEWGMSGESPRPTVDDDFANLLDIDGLQNLL
KDDEDAPSALAFFKKLSKDADPASAELASAWTWKQEEVKGLNRNGYQGLVTTATEVDGYY
VPNDTGCARTEGTKKILNSEKSKYLPHRIKVQKAREEMQAEASKTGKSATVQAQEAAKIA
AEKLLAKGNSRANRVNNRRFVTDLNEQKKTLGGDADVLRFNQLKKRKKPVKFARSAIHNW
GLYAMENIPMNDMIIEYVGEKVRQQVAEFRENRYLQSGIGSSYLFRIDENTVVDATKKGG
IARFINHSCMPNCTAKIITVEKSKRIVIYALRDIAQNEELTYDYKFEREIGSTDRIPCLC
GTAACKGFLN
NT seq 3813 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgtgcgtcgggggcaagctttgctcagttcttcccctctgctcctcgagccgcg
aaggacaaggcgaaggagagagagaaagtcaagtcgcaaggactagactcgcccagcatt
cgacccgtcgcggactccaaggtctcgctgtcattcccacgcgccgatgacgccgcttca
tctcgttttggcgcagagatcaagcccccgccggtgaatggagtcgcggcaacaacagaa
gatagcgactttctgcaaggcgatctcctcaacggagtgggctcagctagctctcacaca
agcaccgtgtcgtctggcttcagcgcacctgctcaacaacccaatatgtcgaccctgggc
ggacctcggaatgttagcagtctaacacccttgacgaacatcgaatcttctccgattcct
gctaccagtcctcagcacaagtctgggacctataccacaacccccaatgagctcaccaat
gctatcgctgttggcacaaattttaccttatctgcccaacctcctgttgaggcagaggca
ccccacatacctaccgattcaagagtatacgctcgcgatcctaataaaggtgtaaaaggc
gtcaaatgtacatacgacccccttctcgataagacggcctcgaaaaaggcgaaagccata
tacaaggagtttggtttggaagatgacgctcccccggcggatccacgattgtccaagccc
ggcggaaagctggattatatcaatacggacttccatcatgccaaatctcgattgcgacaa
accccatatctcctcagaccctacccctacgatcccaagacttcgcttggtcctggtccg
ccaactcaagttgttgttactggatttgatcctctacataatttcgcaaatgtggctgcc
attttctccagcttcggcgaggttgctgagagcagcaacaagctgcatccggagactggg
agttgcttgggctttgctacctttcgataccgtgattcgaaagttatgaagggcgtgcga
ttcgtctctgccattgaggcagcaaagactgctgttcgtaaaggcgtcggattgcgggtt
ggcactcagaatgtcaaggtcgaattcgatccggaaggcaacaagagtagacgcatgatg
gagaatcttctgaagcgcccccaagctgcacagacctcgcagatggcaaaagcagcccct
gctggtgccaaacctgcagaaaagacttctggaccgcctcctaccgcccctaaaggccca
gctgcctcgcgaccaacctaccgacccccgattagcaccgcctttcaactcactaagccg
aaacctccacgctatatcgaaggtgttgaacccatatctgctcagctcctccaccagccg
tttttgtttgttgcaaacgactctgtccccgtcatgccaaccactcccccgcacatgttc
aagcgctgcaagcacttccaggctgaggaggtgaagatggaccaggctggatactacatc
accttcccgactacagaactaggtagggaaaattgctcgcgatgctacagaggtctgaat
caaactctgatgttcaactatacaatgatcatggcaatgtacccttggggatcatctcgt
ccagcggagttacgttacattccctttcattccactcgcagacgcagtgccagtcttccc
aggcaaatcgaagataaggagaagaaggatgccgaggaacgccagagagaagacgaagcc
gatttggaagacgagaagagagaacgtgcgaagaacttcgacccttcgagagaggccatc
gaggttatccgaaaggagttgaaagaccaactggtccggaacattcgaaccaaaatcgcc
gctcctatcctccacaacttcatggatccttctaatcatgtcgcgaagagacgcaaactt
aacatctctgatcccaaagatgccaaactgccccttatccacgaagatgacgaccgagag
gagactcccgttggtacaccaaattctcgtgttgacggagaacgtcgcccaatgagtact
gctcgcctcaatgtctcttctcttccccgaattcgaaaggctaagggtggcaagaaacta
aatattggattccgagacccctttggcagagctcgcccagaagcccgaaagcccgtgatc
cgaccgctcaatcatcgcttcatcaccagtgacgatgaggacacagacgatgatacggag
tccaggtcacgtgttagagacaccgaagagcctgattctcggcctagaagcaggatgagc
tctgaagaatcgactgacgatgcggaagcattcagaaccaaggacgatgttgcttctgtg
gatactcgggatgacgattccatgagtgaagccaacttcgtggttggggagccgactcgt
ccaaagaagcgaaagctcgatctccaagtcgaagcggctctcaaaagacagaagaagacc
gatgaagagctttttggtgttgctcaagacaagatcgaggaagaatttcctttgtcagct
agcaccgtggacgaggatgcactcatgcaggatattgatgccatcgtcaagactgagagt
gaggccgaagctgcttttgcaaagggaaagaagaaagtcgctaccaagaaggcgaagaag
tctaagagacagatcttcgaggagcgtgaagctctcaagcggcaatcagaaggcatctac
atggaagaagctcttcgacaacagagtgaagcaatcgaagaggaagaggaagatgtcatc
attcaaagtgctcctgttgagaccactgtcgaatgggggatgtctggagaatcacctcga
ccaactgttgacgatgatttcgcgaatcttcttgacatcgacggtctgcaaaatctgctg
aaggacgacgaggatgctccatctgctttggctttcttcaaaaagttatccaaggatgct
gatccagcttcagccgagttggcatcagcttggacttggaagcaagaggaagtcaagggc
ctcaatcgcaacggttaccaagggcttgtgacaactgcgactgaagtcgatggttactac
gttcccaacgataccggctgtgctcgtaccgaaggtaccaagaagatcctcaattctgag
aagtctaagtatctccctcatcgcatcaaggtccagaaagcacgtgaggagatgcaggcc
gaagccagcaaaactggcaagtctgccacggtacaggcacaagaagctgcgaagattgct
gccgagaagcttcttgccaaaggaaactcccgtgctaatcgtgtcaacaatcgccgcttc
gttacggatctcaatgagcagaagaagactcttggtggcgacgcagatgtactccgcttc
aatcaactcaaaaagcgaaagaagccagttaagtttgcacgatccgcaattcacaattgg
ggcctgtatgccatggagaacattccgatgaacgacatgatcattgagtatgtgggcgag
aaagtcagacagcaggtggccgagttccgagagaatcgttacttgcagagcggcattgga
agcagttatctcttcagaatcgatgagaacactgttgttgacgctaccaagaaaggcgga
atagccagattcatcaaccacagctgcatgcccaactgcacggccaagatcatcactgtg
gagaagagcaagagaattgtcatctatgcgctgcgtgatattgcccaaaacgaggaactc
acttacgattacaaattcgagcgtgagattgggagtacggaccgtattccttgcctctgt
ggtacagcagcgtgtaaaggattccttaactaa

DBGET integrated database retrieval system