KEGG   Phialocephala scopiformis: LY89DRAFT_723325Help
Entry
LY89DRAFT_723325  CDS       T04865                                 

Definition
(RefSeq) glutamate decarboxylase-like protein-like protein 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
psco  Phialocephala scopiformis
Pathway
psco00250  Alanine, aspartate and glutamate metabolism
psco00410  beta-Alanine metabolism
psco00430  Taurine and hypotaurine metabolism
psco00650  Butanoate metabolism
psco01100  Metabolic pathways
psco01110  Biosynthesis of secondary metabolites
Module
psco_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:psco00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    LY89DRAFT_723325
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LY89DRAFT_723325
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LY89DRAFT_723325
   00430 Taurine and hypotaurine metabolism
    LY89DRAFT_723325
Enzymes [BR:psco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     LY89DRAFT_723325
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 28828530
NCBI-ProteinID: XP_018065089
JGI: 723325
UniProt: A0A194WSS7
LinkDB All DBs
Position
Unknown
AA seq 526 aa AA seqDB search
MTSNSTHLPIRTKSGEQNKPLNRAEEVDDLLNAVQSLIVPFIKAADEDASTKPTGHGLAI
PGGGPRTALVEHHKPEKLSSLMNFDLPGNGTGKEGLLATVEQVLKYSVNTWDQGFLDKLY
SSTNAVGVISELLLAVLNTNVHVFQVSPALSVIEKKTAKAFANLFGFDGPHAGGISTQGG
SASNTTSIIIARNILYPESKTAGNGSHNFVLFTSAHGHYSLEKAAQMCGLGTDNVWSVPI
DAQGRMIPSELLNLVQKAKDEGKTPFYVNATAGTTVLGSYDPFKEISEVCKEHNLWMHVD
GSWGGSVIFSSKQGHKLAGVERADSLAVNPHKMMGVPITCSFLLGPDLTKFHKANTLPAG
YLFHQENEGGEVWDLADLTLQCGRRGDSLKLALAWIYHGSSGFEQQIDHAFSIASYFADQ
VSQRKDFFLVSENPPPCLQVCFYYAKEGKLGSKEENTKTTSEIVQKLIPMGFMVDYAPGE
KGSFFRVVVNRDTRSGTVDGLIIATEEVGEEFVRMERGSENLWRMT
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgacctcaaatagcacccatttaccaattagaaccaagtcaggagaacagaacaagcct
ctgaatcgtgcagaagaggttgatgatttactcaacgccgtccagtcattaattgttcca
ttcataaaagccgcggatgaggatgcttctaccaaacccactggtcatggacttgctatt
ccaggtggcggtcctcgaactgcccttgttgagcatcataaaccagagaaactgtccagc
ttgatgaactttgatttacctggaaatggaactggaaaagaaggtttattggcaacggtt
gagcaagtgctcaagtacagtgtcaatacttgggatcaaggattcttggacaaattatat
tctagcacaaatgcggttggagtcatttcagaacttttgttggcagttctgaataccaat
gtacatgtctttcaagtctcgcctgctctctcggtaatagagaagaaaacagcaaaggct
tttgctaatctcttcggcttcgatggtcctcatgcagggggcatttcaacacaaggggga
agtgcttcgaacaccacctccataatcattgctcgaaacattttatatccagagagtaaa
acagctggaaatggatcacataattttgtcttgttcacttcagcacatggacactactcc
ttggagaaggcagctcagatgtgtgggctcggaacggacaatgtctggtctgtaccaatc
gatgctcagggccgaatgattccttccgagctcttgaacttggttcaaaaagcgaaagac
gaaggcaaaactcctttctatgtcaacgctacagctggaactacagttcttggctcatac
gacccgttcaaggaaatctccgaggtctgcaaggagcacaacctatggatgcacgttgat
ggcagctggggcggatcagtaatcttctcttcaaaacaagggcacaagcttgcaggtgtt
gagcgagcagattccctagccgtcaacccgcacaagatgatgggagttccgatcacgtgc
tcattcctcctcggaccagatctcacaaaattccacaaagcaaacacattacctgctggg
tatctctttcaccaagagaacgaaggaggagaagtctgggatcttgcggatttgacactc
caatgtggtcgtcgaggagatagccttaagctcgctctcgcttggatttaccacggttca
tccggattcgagcaacaaatcgaccatgcgttctccatcgcctcctactttgcggaccag
gtctcgcaacgaaaagatttttttctcgtcagcgagaatcctccaccatgtctgcaagtc
tgcttttattatgccaaggaaggaaagctgggaagcaaggaagagaataccaaaacgaca
agtgagattgtgcaaaagctgataccaatgggttttatggttgattacgctcctggagag
aaaggaagtttcttcagagtagttgtgaatagggatacgagatctggcactgtggatgga
ttgatcatcgctaccgaggaggtgggggaagagtttgtaagaatggagcgtggaagcgag
aatctttggcgtatgacttga

DBGET integrated database retrieval system