KEGG   Pseudogulbenkiania sp. NH8B: NH8B_1004Help
Entry
NH8B_1004         CDS       T01619                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  
malate dehydrogenase [EC:1.1.1.37]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
Citrate cycle (TCA cycle)
Cysteine and methionine metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Glyoxylate cycle
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:pse00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NH8B_1004
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NH8B_1004
   00620 Pyruvate metabolism
    NH8B_1004
   00630 Glyoxylate and dicarboxylate metabolism
    NH8B_1004
  Energy metabolism
   00680 Methane metabolism
    NH8B_1004
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    NH8B_1004
Enzymes [BR:pse01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     NH8B_1004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1008671..1009648)
Genome map
AA seq 325 aa AA seqDB search
MKAPVRVAVTGAAGQIGYSLLFRIASGEMLGKDQPVILQLLDLPQAQTAVKGVMMELEDC
AFPLLAGMIATDDPNVAFKDAQVALLVGARPRSKGMERKDLLEANGAIFTVQGKALNDHA
DRNVKVLVVGNPANTNAYIAMNSAPDLDPKNFTAMLRLDHNRALSQLAAKTGTAVSDIEH
MLVWGNHSPTMYADYRFATVNGESLKAKINDEAWNRDVFLPTVGKRGAAIIEARGLSSAA
SAANAAIDHIHDWVLGTNGKWVTMGIPSDGSYGIPEGVMYGFPVVCENGKYTIVQGLEID
EFSRERMNLTLAELEEERAGVAHLL
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcccctgtacgcgttgccgtgaccggtgcagccggccagattggttatagcctg
ctgttccgcattgccagcggtgaaatgctcggtaaagaccagcccgtcatcctgcaactt
ctggacctgccgcaggcccagaccgccgtcaaaggcgtgatgatggaactggaagactgc
gccttcccgctgctggccggcatgatcgccaccgacgacccgaacgtggctttcaaggat
gctcaggtcgccctgctggtcggcgcccgtccgcgcagcaaaggcatggaacgcaaggac
ctgctggaagccaacggcgccatcttcaccgttcagggcaaggcgctgaacgatcacgcc
gaccgcaacgtaaaagtactggtcgtcggcaacccggccaacaccaacgcctacatcgcc
atgaacagcgctccggacctcgatccgaaaaacttcaccgccatgttgcgccttgaccac
aaccgcgccctgtcgcagctcgcggccaagaccggtaccgccgtatccgacatcgagcac
atgctggtctggggcaaccactccccgaccatgtacgccgactaccgcttcgccaccgtg
aacggcgaatcgctcaaggccaagatcaacgacgaagcctggaaccgcgatgtgttcctg
ccgaccgtgggcaagcgcggcgccgccatcatcgaagcacgcggcctgtcgtcggccgcc
tcggctgccaacgccgccatcgaccacatccatgactgggtgctgggcaccaacggcaag
tgggtgaccatgggcatcccgtccgacggctcctacggcattccggaaggcgtcatgtac
ggcttcccggttgtgtgcgaaaatggcaaatacacgattgttcaaggccttgagatcgac
gagttcagccgcgaacgcatgaacctgaccctggccgaactggaagaagagcgcgcgggc
gttgcccatctgctctga

DBGET integrated database retrieval system