KEGG   Pseudogulbenkiania sp. NH8B: NH8B_1012Help
Entry
NH8B_1012         CDS       T01619                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E1 subunit
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
pse00020  Citrate cycle (TCA cycle)
pse00310  Lysine degradation
pse00380  Tryptophan metabolism
pse01100  Metabolic pathways
pse01110  Biosynthesis of secondary metabolites
pse01120  Microbial metabolism in diverse environments
pse01130  Biosynthesis of antibiotics
pse01200  Carbon metabolism
Module
pse_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pse_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pse00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NH8B_1012
  Amino acid metabolism
   00310 Lysine degradation
    NH8B_1012
   00380 Tryptophan metabolism
    NH8B_1012
Enzymes [BR:pse01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     NH8B_1012
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr OxoGdeHyase_C E1_dh 2-oxogl_dehyd_N PFOR_II
Motif
Other DBs
NCBI-ProteinID: BAK75844
UniProt: G2IZP6
LinkDB All DBs
Position
1015892..1018708
Genome map
AA seq 938 aa AA seqDB search
MYSHSYLFGGNAPFIEELYEQYLADPNGVSSEWRSYFDKLAQAPGAAERDVPHQPIQESF
IQLAKKPALGQRSSAATDWESMQKQVAVLKLISAYRVLGSRQANLDPLKRMDQATIRELD
PATHGLTDADMAVLFNAGSLVGPKKLPLSEILARLKQTYCGNIGLEYMHITTSTEKHWVQ
TRFEGDLSTPRYDSDKKKRIFKQITAAETLERYLHTRYVGQKRFSLEGGESTIAALDHLI
QNATSQGVQELIIGMAHRGRLNVLVNTLGKLPRDLFAEFEGKAMTQLASGDVKYHMGFSS
DIPTADGPMHVSLAFNPSHLEIVNPVVEGSVRARQDRRGDSARNQVVPVLIHGDSAFAGL
GVNQGTFNLSQTRGYGTGGTIHIVVNNQVGFTTSDTRDMRSTLYCTDVAKMVEAPILHVN
GDDPEAVCYVMQAALDYRMTFHKDVVIDLVCYRKLGHNEGDDPFLTQPMMYKKIAKHAGV
RAMYAERLVAEGVLSAEEADGFIRAYRDALDKGEHVEQTVLTNYRREHALDWTPYLGTHW
AHPTDTSLPLADIQRLTEKFTTVPEGFKPHPTVQKVLNARVAMAAGEQPVDWGMAETVAY
ASLVTNGFGVRISGEDSGRGTFSHRHAVVHDQNRERWDQGSYVPLRNMSDNQGEFLVIDS
ILNEEAVMAYEYGYSCTAPDQLVIWEAQFGDFANGAQVAIDQFITSGETKWGRLSGLTTI
LPHGYDGQGPEHSSARLERWLQLCAEHNIQIVMPSEAAQMFHVLRRQVLRPYRKPLVIFL
SKRLLRYKDAMSPVETLTQGSFRPVIGDAGIQDPKKVKRVLLCAGQVYYDLANARKEREL
EQDIAIVRIEQLYPFPTEQVAAELAKFPALKEVMWVQEEPRNQGAWYQIRHRLEGLLGAK
QTLSFAGRPSSASPAVGYMSKHVAQLKDFLDEAMTLNK
NT seq 2817 nt NT seq  +upstreamnt  +downstreamnt
atgtacagtcattcctacctgttcggtgggaatgcaccgttcatcgaggagctgtacgaa
cagtacctcgcggatccgaacggggtgtcgagcgagtggcgcagctacttcgacaagctg
gcacaggctccgggcgccgccgagcgtgacgtgccgcaccagcctatccaggaatccttc
atccaactggccaagaagccggcactgggccagcgcagcagcgcggccacggattgggag
tcgatgcagaagcaggtcgccgtgctcaagctgatctcggcctaccgcgtgctcggctcg
cgccaggccaacctcgatccgctcaagcgcatggatcaggccaccatccgcgagcttgat
ccggccacgcacggcctgaccgatgccgacatggcggtgctgttcaatgccggctcgctg
gtcggcccgaagaaactgccgctgtccgaaatcctggcccgtctgaagcagacctactgc
ggcaacatcggcctcgagtacatgcacatcaccacctcgaccgaaaagcactgggtgcag
acgcgcttcgaaggtgacctgtcgaccccgcgttacgacagcgataagaaaaagcgcatc
ttcaagcagatcacggctgccgagacgctggagcgttacctgcacacccgttacgtcggt
cagaagcgcttctcgctggagggcggtgaatccaccatcgccgcactggatcacctgatc
cagaacgccaccagccagggcgtgcaggaactgatcatcggcatggcccaccgtggccgc
ctgaacgtgctggtgaacacgctgggcaagctgccgcgcgacctgttcgccgagttcgaa
ggcaaggccatgacgcaactggcctccggcgacgtgaagtaccacatgggcttctccagc
gacatcccgaccgccgacggcccgatgcacgtctcgctggcgttcaacccctcgcacctg
gaaatcgtcaacccggtggtggaaggttcggttcgtgcccgccaggatcgtcgtggcgac
agcgcgcgcaaccaggttgtgccggtgctgatccacggtgactcggccttcgctggcctc
ggtgtcaaccagggtaccttcaacctgtcgcagacccgcggctacggtaccggcggcacc
atccatatcgttgttaacaaccaggtcggcttcaccacctccgacacccgcgacatgcgc
tccacgctgtattgcaccgacgtggcgaagatggtcgaagcaccgatcctgcacgtcaac
ggcgacgatccggaagccgtgtgctacgtgatgcaggctgcgctcgactaccgcatgacc
ttccacaaggatgtggtgatcgatctggtgtgctaccgcaagctgggccacaacgagggc
gacgatccgttcctcacccagccgatgatgtacaagaagatcgccaagcacgccggtgtg
cgcgccatgtacgccgaacgcctggtggccgaaggcgtgctgagcgcggaagaggcggac
ggtttcatccgcgcctaccgcgacgcgctggacaagggcgagcacgtcgaacagaccgtg
ctgaccaactatcgccgcgaacacgcgctggactggaccccgtacctgggcacccactgg
gctcacccgaccgacacctcgctgccgctggccgatatccagcgtctgaccgagaagttc
accacggtaccggaaggcttcaagccgcatccgacggtgcagaaggtgctgaacgcccgc
gtcgccatggccgccggcgagcagccggtcgactggggcatggcggaaacggtggcgtac
gcctctctcgtgaccaacggcttcggcgtgcgcatctccggtgaagactccggccgtggt
accttctcgcatcgccatgccgtggtgcatgaccagaaccgcgagcgctgggaccagggc
agctacgtgccgctgcgcaacatgtccgacaaccagggcgagttcctggtgatcgactcg
atcctgaacgaagaagcggtaatggcctacgaatacggctattcctgcaccgctccggat
cagctggtgatctgggaagcccagttcggcgacttcgccaacggcgcccaggtggccatc
gaccagttcatcacctccggcgaaaccaagtggggccgtctgtctggcctgaccaccatc
ctgccgcacggctacgacggtcaggggccggagcactcttccgcccgtctggagcgctgg
ctgcaactgtgtgccgagcacaacatccagatcgtgatgccgtccgaagccgcacagatg
ttccacgtgctgcgccgccaggtgctgcgcccgtaccgcaagccgctggtgatcttcctg
tccaagcgcctgctgcgctacaaggacgcgatgagtccggtcgagaccctgacccagggt
tcgttccgcccggtgatcggcgacgccggcatccaggatccgaagaaggtgaagcgcgtg
ctgctgtgcgccggccaggtgtattacgacctggccaacgcccgcaaggagcgtgagctg
gagcaggacatcgccatcgtgcgcatcgagcagctctacccgttcccgaccgagcaggtc
gccgccgaactggccaagttcccggcgctgaaagaagtcatgtgggtgcaggaagagccg
cgcaaccagggcgcctggtaccagatccgccatcgtctcgagggccttctgggcgccaag
cagacgctgtcgttcgccggccgcccatcttccgcctcgcccgccgttggctacatgagc
aaacacgttgcccagctcaaggacttccttgacgaagcaatgacgctgaacaaataa

DBGET integrated database retrieval system