KEGG   Pseudogulbenkiania sp. NH8B: NH8B_2263Help
Entry
NH8B_2263         CDS       T01619                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
Organism
pse  Pseudogulbenkiania sp. NH8B
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2378138..2380942
Genome map
AA seq 934 aa AA seqDB search
MTASPDPGPDATLAQHTERLLQVIRALEREVHPTHPAGVTLDSTLEGELGFDSLTRVELV
QRLNQAFAVQLPDEALSRTETVRDLLPYLAQPGRAEAPPALMPLRQGSAIEPPRHADTLV
EALLWHVERQPERVHVLLYGEQQTLHPIRYRELFEAGRAIAGGLAARGVTPGETIALMLP
TGLGYLASFIGVMLAGGVPVPIYPPTRLSQLDEHLRRHARILNNAAVVLMITTQQAKPVA
TLLRANVASLAGAVTPEELAGETDRRPFQGTSSALAFLQYTSGSTGDPKGVMLSHANLLA
NIRAMGQVIGITAEDVGVSWLPLYHDMGLIGAWLGSLYHGCPLVLLPTLSFLAQPARWLQ
AVSRHRASLSGAPNFAYELCARKTADSELQGLDLSHWRFAFNGAEPVSPATLERFAARFA
ACGFRRTALTPVYGLAESTVALAFPPLGRGPHIDLIAPEPFATLGQALPAQDDHAALRIP
CCGRPLPNHEIRIVGEDGSELPERQVGRLEFRGPSATRGYYHNPAASTALFHDDWLDSGD
NAYMAEGEVYLTGRVKDLIIRAGRNFYPYDLEEAIGNLPGIRKGCVAVFASADPQQGSER
LVVLAETREQGSAAREQLHQRIRQTATDVVGVPLDEIVLAPPHTVLKTSSGKIRRQACRA
AYEQGMVDHPSADSPWRQSLRLWRESGLARGVIALRQLAAWCYGAYAWAVLLTLALPAGG
LTILLQRPPLGRRLVHAAARLGLILSGLQVRAQGLERLPSQPHVLLLNHSSYLDVLLLTA
LLPAAPGYTFTAKRELSANPLLRALLGGLGTCFIERTDIRQSQHDLDAMVAALQAGENLL
VFPEGTFTRAAGLRPFHLGGFLAAGQARVPVVVAGLRGTRIVLRDGTWLPRRVPIEFEVG
PSVMPSGPDWAAAAALSRSVRPVLAALSGEHDAA
NT seq 2805 nt NT seq  +upstreamnt  +downstreamnt
gtgacagcgagccctgatcccggacccgacgccacgctggcgcaacacaccgagcgcctg
ctgcaggtgatccgtgcactggagcgggaggtgcatccgacccacccagcgggcgtgacg
ctggacagcaccctggaaggcgagctgggcttcgacagcctcacccgggtcgaactggtg
caacggctgaaccaggcgttcgcggttcaactgccggacgaagcgctatcgcgcacggaa
accgtgcgcgacctgctgccgtacctggcacagccgggcagggccgaggcgccgccggct
ctcatgccgctgcggcagggctccgccatcgagccgccacggcacgcggacaccctggtc
gaggccttgctctggcacgtcgagcgccagccggagcgcgtccacgtcctgttatacggc
gagcagcaaacgctccaccccatccgttaccgcgagctgttcgaggcgggcagggcgatt
gccggcggactggcggcacggggggtgacgccaggcgaaaccatcgcactgatgctgccg
accggccttggctatctggcgagcttcatcggcgtcatgctggcaggcggcgtcccggtg
cccatctacccacccacccgcctgagccagctcgacgagcatctgcgtcgccacgcccgc
attctcaacaacgccgctgtcgtgctgatgattaccacgcagcaggcaaagcccgtcgcc
acgctgctgcgcgccaacgtcgccagcctcgccggggccgtcaccccggaagagctggcc
ggggagaccgaccgccggccgttccagggcacatcctcggccctggctttcctgcaatac
acctcgggcagcaccggcgaccccaagggggtcatgctcagccacgccaacctgctcgcc
aacatccgcgccatggggcaggtcatcggtatcaccgcggaggacgtcggggtctcctgg
ctgccgctctaccacgacatgggtctgatcggggcctggctgggttcgctctaccacggc
tgcccgctggtgctgctgcccacgctgagcttcctggcccagccggcacgctggctgcag
gccgtgtcccggcaccgcgcgagcctgtcgggcgcccccaacttcgcgtatgaactgtgt
gcgcgcaagaccgccgacagcgaactgcaaggcctcgacctgtcccactggcgctttgcc
ttcaacggtgccgagccggtgagccccgccacgctggaacgtttcgccgcccgctttgcc
gcctgtggttttcggcgcaccgccttgacgccggtatacgggttggccgaatccaccgtg
gccttggcgtttccaccgctcgggcgaggcccgcacatcgacctgatcgcgccagaaccg
ttcgccaccttggggcaagcccttccggcccaggacgaccacgcggccctgcgcattccc
tgctgcggccgacccttgcctaaccatgaaatccgcatcgtgggcgaggacggatcggaa
ctgccggagcgccaggtgggacggctcgaattccgcggcccttccgcgacacggggttac
taccacaaccccgcggcgagcacggcgttgttccacgacgactggctggattccggtgac
aacgcctacatggccgagggagaggtctacctgacgggccgggtcaaggacctgatcatc
cgtgccggccgcaatttctacccctacgacctggaagaagccatcggcaacctgccgggc
atccgcaaaggctgcgtcgcggtgtttgccagtgccgatccgcagcagggctcggaacgc
ctggtggtgttggccgaaacccgggagcagggcagcgccgcccgggagcaactgcaccag
cgcatccgccagaccgccaccgacgtggtcggggtgccgctcgacgagatcgtgctggcg
cccccgcacacggtcctgaaaacctccagcggcaagatccgccgtcaggcctgccgtgcg
gcgtacgagcagggcatggtcgatcacccgtccgccgactcgccctggcggcagtcgctg
cggctgtggcgggagagcgggctcgcccggggcgtcatcgcgttgcggcagctcgccgcc
tggtgctatggcgcttatgcctgggcggtactcctcaccctggcactgccggccggagga
ctgaccatcctgctgcagaggccgcccctgggccgacgccttgtccatgctgccgccagg
ctcggcctgatactgagtgggttgcaggtgagggcgcagggactggaacgcctgccgagc
cagccccacgtgctgctgctcaaccactccagctatctggatgtgctgttgctcacggcc
ttgctgccggcggcaccgggttacaccttcaccgccaaacgcgaactcagcgccaatccg
ctgctaagagccctgttgggcggactgggaacgtgcttcatcgagcgcaccgatatccgg
cagagccagcatgatctcgacgccatggtcgccgcactgcaagcgggcgaaaacctgctg
gttttccctgaagggacctttacccgcgctgctggactgcggccattccatctgggtggt
tttctcgccgccggccaggcccgtgtgccggtggtcgtggccggactgcgcggcacccgc
atcgtgctgcgggacggcacatggctgccgcgccgggtgccgatcgaattcgaggtcggc
cccagtgtgatgccgagcggccccgactgggccgccgcggccgcactgagccggagcgtg
cggccggttctggcggcgctgagcggcgaacacgatgcggcgtaa

DBGET integrated database retrieval system