KEGG   Pseudogulbenkiania sp. NH8B: NH8B_2596Help
Entry
NH8B_2596         CDS       T01619                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pse  Pseudogulbenkiania sp. NH8B
Brite
Enzymes [BR:pse01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     NH8B_2596 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2734676..2735257
Genome map
AA seq 193 aa AA seqDB search
MEHKLPELPYALDALAPYISKETLEYHYGKHHQTYVTNLNNLIKGTEFENASLEEIVKKS
TGGLFNNAAQVWNHTFYWFGLAPNAGGEPTGALADAINAKWGSFDEFKKAFNAVAAGTFG
SGWAWLVKSPDGSLDLVSTSNAATPLTTDKKALLTCDVWEHAYYIDYRNSRPNYLESFWK
LVNWDFAAKNFAA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggaacacaaactgccggaactcccgtacgcgctggacgccctcgctccgtacatttcc
aaggaaaccctggaataccactacggcaaacaccatcagacctacgtcaccaacctgaac
aacctgatcaagggcaccgagttcgagaacgccagcctggaagaaatcgtcaagaaatcg
accggcggcctgttcaacaacgcggctcaggtctggaaccacaccttctactggttcggt
ctggccccgaacgccggtggcgagccgaccggcgccctggctgacgccatcaacgccaag
tggggctcgttcgacgagttcaagaaagccttcaacgccgtcgccgccggcaccttcggc
tccggctgggcctggctggtgaagagcccggatggctcgctcgacctggtctctaccagc
aacgccgccaccccgctgaccaccgacaaaaaagcgctgctgacctgtgacgtatgggag
cacgcctactacatcgactaccgcaacagccgcccgaactacctggagagcttctggaag
ctggtgaactgggacttcgcagcgaaaaacttcgccgcctaa

DBGET integrated database retrieval system