KEGG   Pseudomonas sp. CCOS 191: CCOS191_3665Help
Entry
CCOS191_3665      CDS       T03967                                 

Definition
(GenBank) peptide synthase
Organism
psec  Pseudomonas sp. CCOS 191
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
I:complement(4163936..4176883)
Genome map
AA seq 4315 aa AA seqDB search
MTDAFELPHSLVQALAQRAAQTPERIALRFLADAPGEQAVLSYRDLDQRARTIAAALQAR
AGFGERAILLFPSGPDYVAAFFGCLYAGVIAVPAYPPESSRQHHQERLLSIIDDAEPRLL
LTVEALCDSLQGLEALAGANAPGLLAVDRLDPQLAAQWREPVLEGSDIAFLQYTSGSTAL
PKGVQVSHGNLVANEQLIRHGFGIDLNPDDVIVSWLPLYHDMGLIGGLLQPIFSGVPCVL
MSPGYFLARPLRWLQAISEYGGTISGGPDFAYRLCSERVSEAALAGLDLSRWRVAYSGSE
PIRQDSLDTFAEKFAACGFTASSFFASYGLAEATLFVSGSRRGQGIGALELDAEAFAANR
AEPGQGSVLMSCGYPQPGHAVCIVDPQRLEVLEDNRVGEIWAGGPSIALGYWRNPEASAR
TFVERDGQTWLRTGDLGFMRDGEVFVTGRLKDMLIVRGQNIYPQDLEKTLEREVDVLRKG
RVAVFAVDDQGEEGIGVAVEISRNVQKAHTPEALINTLRRVIADACRQAPAVVLLLNPGA
LPKTSSGKLQRSACRLRMNDGSLDIYARFPTAQTAQGNGVAGDDLQARIAGIWRELLKVE
AVAADDHFLLLGGNSIAATQVTARLRDELGIQLSLRTLFEAPTLAEYSAAVAAVLAEGGS
AAGTIETQARDQALPQSLAQNRLWLLWQLEPQSAAYNIPAGLYLRGELDVAALQASFQAL
VARHESLRTLFDEVDGQAVQRILPSQAFTLRHLDLEGQSPAEVAARREDEAQQPFDLRQG
PLLRVTLARLDDEEHQLWVTLHHIVADGWSLNILLDEFARLYAAQGQAVQLPELTLGYAD
YGQWQRQWLADGESARQLDYWKNKLGDERPVLDLCTDQPRASQQHSRAARHSLKVPAALT
SALKDLAREQQASLFMVLLAGWQAVLHRYSGQGDIRVGVPNANRPRLETQGMVGFFINTQ
VLRAELDGRLPFAGLLAQARQATLEAQAHQDLPFEQLLEALPQAREQGLFQVMFNHQQRD
LSALRRLPGLLAEELPWHSREAKFDLQLHSEEDHQGRLTLAFDYAAGLFEAATVKRLASH
LLALLEQVCAEPQLAIGEVRLLDEHSQTQLLEWGQAPMASAPRLLVEQLNEQARLSPERT
ALVWEGGQLGYAELHQQANRLAHYLRDKGVGPDTCVAIALERSPQLLVGLLAILKAGGAY
VPLDTDYPAERLAYMLGDCQAGLLLSHSSLLDKLPQVEGVSAIALDQLHLDSWPSQAPGL
HLHGDNLAYVIYTSGSTGQPKGVGNTHAALAERLQWMQASYALDDSDVLMQKAPISFDVS
VWECFWPLVTGCKLVLAGPGEHRDPQRIAQLIQQHAVTTLHFVPPLLQVFVQEPLAAGCT
SLRRLFSGGEALSVALRDRVLQLLPQVQLHNRYGPTETAINVTHWHCQANDGERSPIGRP
LGNVLCRVLDDEFELTAPGVPGELCLGGAGLARGYLGRPGLTAERFVPQPDGDGARLYRS
GDRARWHMPSQALEYLGRLDQQVKVRGFRVEPEEVQAVLLAEPGVAQALVLIHKDAVGAQ
LVGYYSGVEQTEALLAALAERLPAYMVPAQLIHLAQMPLGPSGKVDRKALPAPVWQQREH
VEPQSALQQQVAAIWREVLGRPQVGLQDDFFALGGHSLLATQIVSRTRQALDVELPLKAL
FEASELGAFCAEIARLQGCGARNLQGAIARVDRRQAVPLSYSQQRMWFLWQMDPHSPAYN
VGGMARFQGLLHVDAFERALQALIVRHETLRTTFPSIDGKPYQCVADDSHVQLHWHDFST
LADEARQQRLQQLADDQAHQPFDLERGPLLRACLVKAGEREHYFVLTLHHIVTEGWAMDI
FARELGELYEAFVDERESPLAPLPVQYLDYSVWQRQWLESGEGDRQLAYWKDRLGDEHPV
LALPADRPRPAVQSHRGELYRFDLDPALVKRVHAFNSQRGLTLFMTMTATLAALLHRYSG
QRDLRIGAPVANRIRPESEGLIGAFLNTQVLRCELDGQMSAGALLDQVRQTIIDGQSHQD
LPFEQLVEALQPPRSSAYNPLFQVMCNVQRWAFQQSRELVGMQVDYLVNDASATKFDLYL
EVTDLDGRLGCCFTYSRDLFDEPRIARMAEHWQQLLVALIDDPQQRLCELPMLADAEQQV
LIGQLQGEQDFALDQTLHGLFAAQAERTPQAPALTFAGQHLSYAELDQQANRLARALRER
GVGPQVRVGLALERSLEMVVGLLAILKAGGAYVPLDPEYPLDRLRYMIEDSRLGLLIGQR
ALLDTLGELPPGVARWSLEDDAANLSAYSDAALDNLNLPQHQAYLIYTSGSTGKPKGVVV
SHGEIAMHCKAVIAEFGMRSDDCELHFYSINFDAASERLLVPLLCGARVVLRAQGQWGAE
EICQLVREQQVSVLGFTPSYGSQLAQYLAGQGEQLPVRLVITGGEALTGEHLQRIRQAFA
PQQFFNAYGPTETVVMPLACLAPEQIPVDAGSVPIGRVIGARTAYILDEDLALLPQGGIG
ELYVGGAGLAQGYHDRPGLSAERFVADPFSHAGGRLYRTGDLVRLRADGLVEYVGRADQQ
VKIRGFRIELGEIESRLQEHADVEEAVVLALDLPGGKQLVGYLVCPQASADGEAQALLRE
AVKADARQHLPDYMVPAHLVLLDSLPLMGNGKLDRRALPAPDLEHARQHYQAPANELESQ
LAQIWREVLNLPRIGVQDNFFELGGDSILSIQVVSRARQLGLQFTPRDLFQHQTIQTLAA
VVTRSEAPSAIEQGARQGSAGLTPIQHWFFDSEVPQPQHWNQAVLLQARQPLQAEALERA
LAALVQHHDSLRLRFGQANGRWQAEYAQPSTQPLLWTATVSDFDDCQALYIDVQRSLDLA
EGPLLRALLVSDDQGVQRLLLAIHHLVVDGVSWRVLLEDLQALYRGETLAAKTHAMGDWA
ARLASYAGSDSLRDELSWWEAQLGNARRELPCDHPQGGNLHRHARSLAIDLNVEQTRQLL
QQAPAAYHTQVNDLLLTALARTLCHWSGDEQVLVQLEGHGRDGLFEDMDLTRSVGWFTNA
YPLSLSPVMAEGEVGRAASIKRIKEQLRQVPHKGQGYGVLRYLADEAGRERMAALPQARI
TFNYLGQFDQQFDQAALFQPLDAPAGLAHDLDAPLPNWLSVDGQVYGGALQLRWSFSAER
YDEATIARLAEAYRQELLALVAHCLADGNGSFTPSDFPLAQLTQEQIDTLPIPAAEIEDV
YPLTPMQEGLLLHTLLEPGTGIYYMQDRYRINSALDPERFAQAWQAVVARHEALRASFSW
NAGEAMLQIIHKPGKTAVDYQDWRGLDEHAQEARLQTLHKEEREAGFELLREAPFHLRLV
RVDDARYWFMMSNHHILIDAWCRSLLMNDFFEIYQALGEGRQAQLAVPPRYRDYIGWLQR
QDLDEARQWWQANLAGFERATAIPSDRPLRHDHAGDGMVVGDCYTRLQVSEGARLRELAQ
AHQLTVNTFAQAAWALTLARYSGDRDVVFGVTVAGRPVSMPQMQRTVGLFINSIALRVQL
PQPGERSSVRQWLQGLLDRNMQLREYEYLPLVAIQECSELPKGQPLFDSLFVFENAPVET
AVLDHAQHLDASSDSGRTHTNFPLTAVCYPGDDLGLHLSFDQRYFDFPTVERLLAEFKRL
LLALVEGFEGEVGELPLLGADEQRFLLVDCNRTEHAYALEQSYVELFEARVAAHPQRTVA
RCEAAAYDYAGLNVAANRLGHALVAAGVAIDQPVALLAERGLALLGMIVGSFKAGAGYLP
LDPGLPAARLQRIVELSRTPVLVCSAACAEQARQLLDEVAGAARPKLLVWEDVQASNVAS
HNLGIHSAPDNLAYVIYTSGSTGLPKGVMVEQRGMLNNQLSKVPYLALDEQDVIAQTASQ
SFDISVWQFLAAPLFGARVEIVPNAIAHDPQGLLSHVQATGITVLESVPSLIQGMLANDH
QALDGLRWMLPTGEAMPPELAAQWLQRYPAIGLVNAYGPAECSDDVAFFRVDAASTQGSY
LPIGTPTDNNRLYLLGEDQTLVPLGAVGELCVAGTGVGRGYVGDPLRTAQAFIPHPYGAP
GERLYRTGDLARRRPDGVLEYVGRIDHQVKIRGYRIELGEIEARLHEQPELRDAAVGVQE
GVNGKHLVGYLVAHQGVSADAALLDQLKQRLRAELPEYMVPLHWGWFDSLPHNANGKLDR
KALPAIDIGGQHSQDYLAPRNELEETLAGIWADVLKAERVGVRDNFFELGGHSLLATQIA
SRVQKALQLNVPLRAMFECSTVEELADYVRGLQDSALDDAKVDRLSDLMAELEAL
NT seq 12948 nt NT seq  +upstreamnt  +downstreamnt
atgacggacgccttcgaactcccgcactcgctggtccaggccctggcgcaacgcgccgcc
cagaccccggagcgcatcgccttgcgcttcctcgctgatgcgcccggcgagcaggcggtg
ctcagttaccgagacctcgaccagcgcgcccggaccattgccgcggcgttgcaggccagg
gccgggtttggcgagcgtgccatcctgttgtttcccagtgggccggactatgtcgcggca
ttcttcggttgcctgtacgccggggtgatcgccgtgccggcctacccgccggagtcttcg
cgccagcaccatcaggaacgcctgctgtcgatcatcgacgacgccgagccgcgcctgctg
ctgacggtagaggcgctgtgtgacagtttgcagggcctcgaagccctggctggcgccaac
gccccgggcctgctggcggtggatcgtctggatccgcagctggccgcgcagtggcgcgag
ccggtgctggaaggcagcgacatcgccttcctgcaatacacctccggctccaccgcgctg
cccaagggcgtgcaggtcagccacggcaacctggtggccaacgaacagctgatccgccac
ggtttcggcatcgacctgaacccggacgacgtgatcgtcagctggctgccgctgtaccac
gacatgggcctgatcggtggcctgctgcagccgatcttcagtggtgtgccttgcgtgctg
atgtcgccgggctatttcctcgcccgaccgttgcgttggctgcaggcgatcagtgagtac
ggcggcaccatcagtggcggcccggacttcgcctaccggctgtgcagcgagcgggtcagc
gaggccgcgctcgccggcctggacctgagccgctggcgcgtggcctattcggggtccgag
ccgatccgccaggacagtctcgataccttcgctgaaaagtttgccgcctgcggcttcacc
gccagcagcttcttcgccagctatggcctggccgaggccaccctgttcgtcagcggcagc
cgccgtggccagggtatcggcgcgctggaactggatgccgaggcctttgccgccaaccgc
gccgagcccggccagggcagcgtgctgatgagctgcggctacccgcagccgggccacgcg
gtgtgcatcgtcgacccgcagcgcctggaggtgctggaagacaaccgggtcggcgagatc
tgggccggcggcccgagcatcgccctgggctactggcgcaaccccgaggccagcgcgcgg
acctttgtcgagcgtgacggccagacctggctgcgcaccggcgatctcggcttcatgcgc
gatggcgaagtgttcgtcaccgggcgcttgaaggacatgcttatcgtccgtggccagaat
atctacccgcaggacctggaaaagaccctggagcgtgaggtcgatgtgctgcgcaagggc
cgggtggcggtgttcgccgtcgacgaccagggcgaggagggcatcggcgtggcggtggag
atcagccgcaatgtgcagaaggcgcacacgcccgaggcgctgatcaataccctgcgccgg
gtcattgccgatgcctgtcgccaggcgccggccgtggtgttgctgctcaacccgggcgcc
ttgcccaagacctccagcggcaagctgcagcgctcggcctgccgcctgcgcatgaacgac
ggcagcctggatatctatgcgcggttcccgacggcgcaaacggcgcagggcaatggcgtg
gccggtgacgacctgcaggcacggatcgcgggtatctggcgtgagctgctcaaggtcgag
gcggtggcggcggacgaccacttcctgctgctgggtggcaactccatcgccgccacccag
gtgaccgcgcgcctgcgcgacgaactgggcatccagctcagcctgcgcaccctgttcgaa
gcaccgaccctggccgaatacagcgccgccgtggcggccgtccttgccgaaggtggcagt
gccgccggcaccatcgaaacccaggctcgcgaccaggccctgccgcagtcactggcacag
aaccgtctgtggctgttgtggcagctggagccgcagtccgccgcctacaacatccccgcc
ggcctgtacctgcgcggcgagctggatgtcgcggcgctgcaggccagcttccaggccctg
gtggcacgtcatgaatccctgcgcacgttgttcgacgaagtcgacggccaggccgtgcaa
cgcatcctgccgagccaggcgttcaccctgcgtcatctggacctcgaagggcagtctccc
gccgaggtggccgcgcgccgcgaggatgaggcgcagcaaccgttcgatctgcgccagggc
ccgctcctgcgggtgaccctggcccgcctggacgacgaagagcaccagctgtgggtgacc
ctgcaccacatcgtcgccgacggctggtcgctgaacatcttgctggatgagttcgcccgt
ctgtatgccgcccagggccaggccgtgcaactgcccgaactgacgctgggctacgccgac
tacggccagtggcagcgtcagtggctggccgatggcgaaagcgcccgccagctcgactac
tggaagaacaagctgggtgacgaacggccggtgctcgacctgtgcaccgaccagccccgc
gccagccagcagcacagccgcgccgcgcgccacagcctcaaggtacctgcggcactgacc
agcgccctcaaggacttggcccgcgagcagcaggccagcctgttcatggtcctgctggcc
ggctggcaggccgtgctgcaccgctacagcggccagggcgacatccgcgtcggcgtgccc
aacgccaaccgcccgcgcctggaaacccagggcatggtcggcttcttcatcaacacccag
gtgctgcgcgccgagctcgacggccgcctgccgttcgccgggctgctggcccaggcgcgc
caggccaccctggaggcccaggcccatcaggacctgcccttcgagcaactgctcgaggcg
ctgccgcaggcccgggaacaaggcctgttccaggtcatgttcaaccaccagcaacgcgac
ctgtcggccttgcgtcgcctgcccggcctgctcgccgaagagctgccgtggcacagccgc
gaggccaagttcgacctgcagttgcacagcgaggaagaccaccagggccgcctgacgctg
gccttcgactacgccgccgggttgttcgaggcggccaccgtcaagcgcctggccagccat
ctgctggccttgctcgaacaggtctgcgccgaaccgcagctggccattggtgaggtgcgc
ctgctcgacgagcacagccagacgcaactgctcgagtggggccaggcgcccatggcgagc
gcgccgcgcctgctggtcgagcaactcaacgaacaggcgcgcctgagccccgagcgcacc
gcgctggtgtgggagggcggtcagcttggctatgccgaactgcaccagcaggccaaccgc
ctggcgcactacctgcgcgacaagggcgtcggcccggacacttgcgtggcgattgccctg
gagcgttcgccgcagctgctggtcggcctgctggccattctcaaggccggtggcgcctac
gtgccgctggacaccgactaccctgccgagcgcctggcctacatgctcggtgattgccag
gctggcctgctgctcagccacagcagcctgctcgacaaactgccgcaggtcgaaggcgtg
agcgccatcgccctcgaccagttgcacctggacagctggccaagccaggcccccggcctg
cacctgcacggcgacaacctcgcctatgtgatctacacctctggctccaccggccagccc
aagggcgtgggcaacacccatgccgcgctggccgagcgcctgcagtggatgcaggccagc
tatgcgctggatgacagcgacgtgctgatgcagaaggcgccgatcagcttcgacgtgtcg
gtgtgggagtgcttctggccgctggtcaccggttgcaagctggtcctggccggccccggc
gaacatcgcgatccgcaacgcatcgcccagctgatccagcaacacgcggtgaccacgctg
cacttcgtgccgccgttgctgcaggtgttcgtccaggagccgttggccgccggctgcacc
agcctgcgccggttgttctccggtggcgaggctttgtccgtcgccttgcgtgaccgcgtg
ctgcaattgctgccacaggtgcaactgcacaaccgctacggcccgaccgaaaccgcgatc
aacgtcacccactggcactgccaggcgaatgacggcgagcgctcgcccatcggccgcccg
ctgggcaacgtgctgtgccgggtgctggacgatgagttcgagttgaccgcgccgggcgtg
cccggcgagctgtgcctggggggcgcgggcctggcccgtggctacctcggtcgcccgggg
ctgactgccgagcgcttcgtgccgcagcccgatggcgacggcgcacggctgtaccgcagc
ggcgaccgcgcccgctggcacatgccgagccaggccctggagtacctcgggcgcctcgac
cagcaggtcaaggtgcgcggcttccgcgtcgagccggaggaggtgcaggcggtgctgctg
gccgagccgggtgtcgcccaggcactggtgctgatccacaaggatgctgtcggtgcccag
ctggtgggctattacagcggtgtcgagcagaccgaggcgctgctggccgctctggccgag
cgcctgccggcctacatggtgccggcacaactcatccatcttgcgcagatgcccctgggg
ccgagcggcaaggtcgatcgcaaggcgctgccggcaccggtctggcagcaacgtgaacat
gtcgagccgcaaagcgcgttgcaacaacaggtcgcggcgatctggcgcgaggtgctgggc
cggccgcaggtcggcttgcaggatgacttcttcgccctcggtggccactcgttgctggcc
acccagatcgtctcgcgcacccgccaggcgctggatgtcgagttgccgctcaaggccttg
ttcgaggccagcgagttgggcgcgttctgcgccgagattgcccgtctgcagggttgcggc
gcacgcaacctgcaaggtgccatcgcccgtgtcgaccgccgccaggcggtgccgctgtcg
tactcgcagcagcgcatgtggttcctctggcagatggatccgcacagccccgcctacaac
gtcggcggcatggcgcgcttccagggcctgctgcatgtggacgccttcgagcgcgccctg
caggcactgatcgtgcgtcacgaaaccctgcgcaccaccttccccagcatcgacggcaag
ccgtaccagtgcgtggccgatgacagccacgtgcaactgcactggcatgacttcagcacc
ctggccgacgaggcccgccagcaacgcctgcagcaactggccgatgaccaggcgcaccag
ccgttcgacctggagcgcgggccgctgttgcgcgcctgtctggtcaaggccggcgagcgc
gagcactacttcgtcctgaccctgcaccatatcgtcaccgaaggctgggccatggacatc
tttgcccgcgaactgggcgagctgtacgaggccttcgttgacgagcgcgagtcgccgctg
gcgccgctgccggtgcagtacctcgattacagcgtgtggcagcgccagtggctggaaagc
ggcgagggcgatcgccagctggcctattggaaggaccgcctgggcgacgagcatccggtg
ctggcgctgcccgccgatcgcccacgcccggcggtgcagagccaccgcggcgagctgtac
cgcttcgacctggatccggcgctggtcaagcgcgtgcacgccttcaacagccagcgcggc
ctgaccctgttcatgaccatgaccgccaccctggccgcgttgctgcaccgctacagcggc
cagcgcgacctgcgcatcggcgcgccggtggccaaccgcattcgcccggaaagcgagggg
ctgatcggcgccttcctcaacacccaggtgctgcgttgcgaactggacgggcagatgagc
gccggcgcgttgctcgaccaagtgcgccagaccatcatcgatggccagtcgcaccaggac
ctgccgttcgagcaactggtcgaagccctgcagccgccgcgctcgagcgcctacaacccg
ctgttccaggtgatgtgcaacgtgcagcgctgggccttccagcaaagccgtgagctggtg
ggcatgcaggtggattacctggtcaacgatgccagcgccaccaagttcgacctgtacctg
gaggtcaccgacctcgacggccgcctgggctgctgcttcacctacagccgcgacctgttc
gatgagccgcgcatcgcgcgcatggccgagcactggcagcagttgctggtggcgctgatc
gacgatccgcagcagcgcctgtgcgaactgccgatgctggctgacgccgagcagcaggtg
ctgatcggccagttgcagggcgagcaggatttcgcgctggaccagacgctgcacgggctg
ttcgccgcccaggctgaacgcactccgcaggccccggccctgaccttcgccggccagcac
ctgagctacgccgagctcgaccagcaggccaaccgcctggcccgcgccctgcgcgagcgc
ggcgtcggcccgcaggtgcgggtgggcctcgcgctggagcgatcgctggagatggtggtc
ggcctgctggccatcctcaaggccggcggcgcctacgtgccgctggacccggaatacccg
ctcgaccgcctgcgctacatgatcgaggacagccgcctgggccttctgatcggccagcgg
gcgttgctcgacaccctgggcgaactgccgccgggcgttgcccgctggagcctggaggac
gatgccgcgaacctgtccgcctacagcgacgctgccctggacaacctcaacctgccgcag
caccaggcctacctgatctacacctccggctccaccggcaagcccaagggcgtggtggtc
agccacggtgaaatcgccatgcactgcaaggcggtgatcgccgagttcggcatgcgcagc
gacgactgcgagctgcatttctattcgatcaacttcgacgccgccagcgagcgcctgctg
gtgccgctgctgtgcggtgcccgcgtggtgctgcgtgcccaagggcagtggggcgccgag
gaaatctgccagctggtgcgcgagcagcaagtcagcgtgctcggtttcaccccgagctac
ggcagccagttggcccagtacctggccgggcagggcgagcaattgccggtgcgcctggtg
atcaccggtggcgaggccttgaccggcgagcacctgcaacgcatccgccaggcctttgcg
ccgcaacagttcttcaacgcctacggcccgaccgaaacggtggtgatgccactggcctgc
ctggcgccggagcagataccggtcgacgccggcagcgtgccgatcggccgggtcatcggt
gcccgcaccgcctatatccttgacgaggacctggcgctgctgccgcaaggtggcatcggt
gagctttacgtcggcggtgccggcctggcccaggggtatcacgaccgtccgggcctgagc
gccgaacgtttcgtcgccgacccgttcagccatgccggcggtcgcctgtaccgtaccggc
gacctggtgcgcctgcgcgccgatggcctggtggagtatgtcgggcgggccgaccagcag
gtgaagatccgtggcttccgtatcgagctgggcgagatcgagagtcgcctgcaggagcac
gccgacgtcgaggaggcggtggtcctggccctcgacctgccgggtggcaagcaactggtg
ggttacctggtgtgcccacaggccagcgccgacggcgaggcccaggccctgctgcgcgag
gcggtcaaggccgatgcccgccagcacctgcccgactacatggtgccggcgcacctggtg
ctgctcgacagcctgccactgatgggcaacggcaagcttgaccgccgcgcgttgccggcc
ccggatttggagcacgcgcgtcagcactaccaggctccggccaacgagctggaaagccag
ctggcgcagatctggcgcgaggtgctcaacctgccgcgcatcggcgtgcaggacaacttc
ttcgaactgggcggcgactcgatcctgtcgatccaggtggtcagccgtgcccgtcagctg
gggctgcagttcaccccgcgtgacctgttccagcaccagaccatccagaccctggcggca
gtggtgacccgcagcgaggcgccgagcgcgatcgagcagggcgcacgtcagggcagcgcc
ggcctgacgccgatccagcactggttcttcgacagcgaagtgccgcagccgcagcactgg
aaccaggcggtgctgctgcaggcgcgccagccgttgcaggccgaggcgctggagcgggct
ttggccgcgctggtgcaacaccacgacagcctgcgcctgcgctttggccaggccaacggc
cgctggcaggccgagtacgcccagccgagcacccagccgttgctgtggaccgcgacggtg
agcgatttcgacgactgccaggcgctgtatatcgatgtgcagcgcagcttggacctggcc
gaggggccgctgctgcgcgccttgctggtcagcgatgaccagggcgtccagcgcctgctg
ctggcgatccaccacctggtggtcgatggcgtgtcctggcgcgtcctgctggaagatctg
caggcgctgtaccgcggtgaaaccctggccgccaagacccatgccatgggcgactgggcg
gcgcgcctggccagctatgccggcagcgattcgctgcgcgacgagctgagctggtgggaa
gcgcaactgggcaacgcccgtcgcgaactgccctgcgatcatccccagggcggcaacctg
caccgccatgcccgcagccttgccatcgacctgaacgtggaacagacccgccaactgctg
caacaggcgccggcggcctaccacacccaggtcaacgatctgctgctgactgccctggcg
cgcacactgtgccactggagcggcgacgagcaggtgctggtgcagctggaaggccatggc
cgcgatggtctgttcgaggacatggacctgacccgcagcgtcggctggttcaccaacgcc
taccctctgagcctgagccccgtaatggccgagggcgaagttggccgcgccgcgtcgatc
aagcgcatcaaggaacaactgcgccaggtgccgcacaaaggccagggctacggtgtgctg
cgctacctggccgacgaggccgggcgtgagcgcatggccgccttgccccaggcccggatc
accttcaactacctcggccagttcgaccagcagttcgaccaggcggcactgttccagccg
ctggatgcaccggcgggcctggcccatgacctggatgcgccgctgccgaactggctgagc
gtcgatggccaggtctatggcggcgcgctgcaactgcgctggagcttcagtgccgagcgc
tatgacgaggcgaccatcgcccgcttggccgaggcctatcgccaggagctgctggcgttg
gtcgcccactgcctggcggacggcaacggcagcttcaccccctcggacttccccctggcg
caactgacccaagagcagatcgacacgctgccgatcccggccgccgagatcgaggacgtc
tacccgctgacgccgatgcaggaaggcctgttgctgcacaccctgctcgagccgggcacc
ggcatctactacatgcaggaccgctaccgcatcaacagcgccctcgaccccgagcgcttc
gcccaggcctggcaggcagtggtggcgcgccacgaggcattgcgcgcctcgttcagctgg
aacgccggcgaagcgatgctgcagatcatccacaaacccggcaagaccgcggtggactac
caggactggcgcggccttgacgagcacgcccaggaagcgcgcctgcaaacgctgcacaag
gaggagcgcgaggccggcttcgagctgctgcgcgaagcaccgttccacctgcgcctggtg
cgcgtggacgatgcgcgttactggttcatgatgagcaaccaccacatcctcatcgatgcc
tggtgccgctcgctgctgatgaacgacttcttcgagatctaccaggccctgggcgaaggg
cgccaggcccagttggcggtgccgccgcgctaccgcgactacatcggctggctgcagcgc
caggacctcgacgaggcgcgccagtggtggcaggccaacctggccggcttcgagcgcgcc
acggcgatccccagcgaccgtccgctgcgccatgaccacgccggtgacggcatggtcgtg
ggtgactgctacacccgcctgcaagtgagcgagggcgcccgcctgcgtgaactggcccag
gcccaccaactgacggtcaacaccttcgcccaggcggcctgggccctgaccctggcgcgc
tacagcggcgatcgcgacgtggtgttcggcgtcaccgtggccgggcgtccggtgagcatg
ccgcagatgcagcgcacggtcggcctgttcatcaacagcatcgccctgcgcgtgcagttg
ccgcagccgggcgagcgcagcagcgtgcgccagtggctgcagggcttgctcgatcgcaac
atgcagttgcgtgaatacgagtacctgccgctggtggcgatccaggaatgcagcgaactg
cccaagggccagccgctgttcgacagcctgttcgtattcgagaacgccccggtggaaacg
gcggtgctcgaccacgcccagcacctggacgccagctccgactcgggccggacccacacc
aacttcccgctgaccgcggtgtgctacccgggcgatgacctggggctacacctgtcgttc
gaccagcgctacttcgacttcccgaccgtcgagcgcctgctcgccgaattcaagcgcttg
ctgctggcgctggtcgagggcttcgaaggcgaggtcggcgagctgccgctgctgggggcc
gacgaacaacgtttcctgctcgtggactgcaaccgcaccgagcatgcctatgcgctggag
cagagctacgtcgagctgttcgaggcgcgggtggccgcgcatccgcagcgcaccgtcgcc
cgttgcgaggcggccgcttacgactatgcgggcctgaacgtggcggccaaccggctgggt
catgccttggttgcggccggcgtggccatcgaccaaccggtggcgctgctggccgagcgt
ggcctggcgctgctgggcatgatcgtcggcagcttcaaggccggcgctggctacctgccg
ctggatccgggcctgccggcggcgcgcctgcaacgcatcgtcgagctgagccgcacgccg
gtgctggtgtgcagcgcggcctgcgccgagcaggcgcgccagctgctcgatgaagtagcg
ggcgcggcgcggccgaagctgctggtctgggaagacgtgcaggcaagcaacgtggccagc
cacaaccttggcatccacagcgcgccggacaaccttgcctacgtgatctacacctccggc
tccaccggcttgcccaagggcgtgatggtcgagcagcgcggcatgctcaacaaccagctg
agcaaggtgccgtacctggccctggacgagcaggacgtgatcgcccagaccgcctcacag
agcttcgacatctcggtgtggcagttcctcgccgcgccgctgttcggggcccgtgtggag
atcgtgccaaacgccatcgcccatgatccgcaaggcctgctgagccatgtgcaggccacc
ggcatcaccgtgctggagagtgtgccgtcgctgatccagggcatgctggccaacgatcac
caggccctcgatgggctgcgctggatgctgccgaccggcgaggccatgccgcccgagctg
gccgcccagtggctgcagcgctacccggccatcggcctggtcaacgcctacggcccggcg
gagtgctcggacgacgtggcgttcttccgcgtcgatgccgcctcgacccagggcagctac
ttgccgatcggcacgccgaccgacaacaaccgcctgtacctcctcggcgaagaccagacc
ctggtgccgctgggcgcggtgggcgagctgtgcgtcgccggtaccggtgtgggccgtggc
tatgtcggagatccgctgcgcaccgcccaggccttcattccgcatccgtacggtgcgccc
ggtgagcgcctgtaccgcaccggcgacctggcgcggcgccgtccggatggcgtgctggag
tacgttgggcgcatcgaccatcaggtgaagatccgcggctaccgcatcgaactgggcgag
atcgaggcgcgcctgcacgaacagccggagctgcgcgatgccgcggtgggcgtgcaggag
ggcgtcaacggcaagcatctggtcggctacctggtggcgcaccagggcgtcagtgccgac
gccgcgctgctcgaccagctcaagcagcgcctgcgcgccgagttgccggagtacatggtg
ccgctgcactggggctggttcgacagcctgccgcacaacgccaacggcaagcttgaccgc
aaggcgctgccggccatcgatatcggtggccagcacagccaggactacctggcaccgcgc
aacgagcttgaagagaccctcgccgggatctgggccgatgtgctcaaggccgagcgggtg
ggtgtgcgcgacaacttcttcgagctgggcgggcattcgctgctggcaacgcagatcgcc
tcgcgggtgcagaaggccctgcagttgaacgtgccgttgcgggcgatgttcgagtgcagc
actgtggaagagctggcggactatgtgcgcgggctgcaggacagcgcgctggatgacgcc
aaggtcgatcggctgagcgacctgatggcggagctggaggcgttgtaa

DBGET integrated database retrieval system