KEGG   Pseudomonas sp. StFLB209: PSCI_0639Help
Entry
PSCI_0639         CDS       T03623                                 

Definition
(GenBank) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
pses  Pseudomonas sp. StFLB209
Brite
Enzymes [BR:pses01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     PSCI_0639
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: BAP41341
UniProt: A0A077LC17
LinkDB All DBs
Position
697857..698384
Genome map
AA seq 175 aa AA seqDB search
MKHTLWLGLLGAFSLSAHAASLDVPVNIVSADGAPKAAGSVHVEETQYGLLFTPKLSGLP
AGIHGFHVHQNPSCDAAEKDGKKVAALAAGGHFDPANTGKHLGPYDDKGHLGDLPAIYVT
ADGKAEYPVLAPRIKKLDEIKGRALMVHAGGDNHSDHPAPLGGGGDRYACGVIKG
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatactctctggctcggtctgctcggtgcattttcccttagcgctcacgcggcc
tcactggacgtcccggtcaatatcgtcagcgccgatggcgcgcctaaagcggccggcagc
gtgcatgtcgaagaaacccagtacggcctgctgttcaccccgaaactcagtggcctgccg
gccggcattcatgggttccatgtccatcagaacccgagctgcgacgcggccgagaaagat
ggcaaaaaagttgccgctctggcagccggcggtcactttgacccggccaacaccggcaag
catttgggcccatacgacgacaaggggcatctgggcgacctgccggcgatctacgtgacc
gctgacggcaaggccgagtacccggtcctggccccgcgtatcaaaaagctcgacgaaatc
aaaggccgtgccttgatggtccatgccggtggcgataaccactctgaccaccctgccccg
ctgggcggtggcggtgatcgttatgcctgcggcgtgatcaagggctga

DBGET integrated database retrieval system