KEGG   Pseudovibrio sp. FO-BEG1: PSE_0143Help
Entry
PSE_0143          CDS       T01669                                 

Gene name
sodC
Definition
(GenBank) Copper/zinc superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
psf  Pseudovibrio sp. FO-BEG1
Brite
Enzymes [BR:psf01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     PSE_0143 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AEV34655
UniProt: G8PHH3
LinkDB All DBs
Position
complement(144517..145122)
Genome map
AA seq 201 aa AA seqDB search
MKLNGLAAVVAAGFAVASFAAMASKEDQVPAGPTAVAVMKDADGKQVGRVVLTETPSHIL
HITASFDGLPPGVHGFHVHETGLCEPTFSAAGGHFAPEGNEHGVGVAGGPHAGDLPNLHV
PENGKLVVEYFTERLDLAPDDPDSLIGGPGRALIVHADPDDYHSQPTGDAGGRIACGVIV
PVTQNADGFQSYPEEPVSDTK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgaatggattggcagccgttgttgctgctggttttgctgttgcaagttttgct
gcgatggcttcgaaagaggatcaggttcctgctggtccaactgctgttgctgttatgaaa
gacgcagatggcaagcaggttggccgagtggtgttgacagaaacgccgagccacatcctt
cacatcactgcttcgtttgatgggcttcctcctggggtgcacggcttccatgtgcacgag
accggcctttgtgagccaaccttctcagctgctggtggacactttgcgccggaagggaat
gagcatggcgttggcgttgctggtgggccgcatgcgggtgatttgccgaacctgcatgtg
ccggaaaacgggaagctggtggtggagtactttacggagaggctcgaccttgcgcctgat
gatccggacagtctgattggcggaccgggaagggcgctgattgtgcatgcggaccctgat
gactatcacagtcagccaacgggtgatgcgggtggacggattgcctgtggggtgattgtg
cctgtgacgcaaaatgcagatggtttccagagctatcctgaagagccagtgagcgacacc
aagtag

DBGET integrated database retrieval system