KEGG   Pseudovibrio sp. FO-BEG1: PSE_0274Help
Entry
PSE_0274          CDS       T01669                                 

Definition
(GenBank) glutathione S-transferase family protein
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:psf00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PSE_0274
Enzymes [BR:psf01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     PSE_0274
Transporters [BR:psf02000]
 Other Transporters
  Pores ion channels [TC:1]
   PSE_0274
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
268918..269520
Genome map
AA seq 200 aa AA seqDB search
MYKVIGHPQSRTMRVLWLLEELDLPYEVVPSKPHHENVYAVNPSGKIPALIVGDETIYDS
TAICTYLADKHSGLSFPAGTLERAQQDSFTNFALDEMDSILWMAAKHSFIHPEDQRVPDI
KPACRFEWARSMKHLEARLKGKTWAMGDTFTISDIIIGHCAFWAKVSKFEWPEGPVSDYF
SRVLARPALAKANEKALAQL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaagttattggacacccgcaatcaagaaccatgcgggttttatggctcttggaa
gaactggatctgccttacgaggtcgttccaagtaaaccgcaccatgaaaatgtttatgcc
gtaaatccttcaggcaaaattcctgccctgatcgtcggcgatgaaaccatttacgattca
acagccatctgcacatatctggcagacaaacattcaggcctttccttcccagctggaact
ctggaacgcgcccagcaagacagtttcacaaactttgcactggatgagatggattcaatc
ctctggatggctgcaaaacactcattcattcacccggaagatcagcgcgtccccgacatc
aaaccagcctgtcgtttcgagtgggcaagatcgatgaagcatcttgaagcccgtttgaaa
ggtaagacatgggcgatgggagacaccttcaccatttccgacatcatcatcggacactgc
gcattctgggccaaagtttccaagtttgagtggccagaaggcccagtaagcgactatttc
tcaagagttttggcgcgaccagctctggcaaaagctaatgaaaaagcccttgctcaactc
tga

DBGET integrated database retrieval system