KEGG   Pseudomonas stutzeri RCH2: Psest_3257Help
Entry
Psest_3257        CDS       T02391                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
psh  Pseudomonas stutzeri RCH2
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:psh00001]
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Psest_3257
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Psest_3257
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Psest_3257
Enzymes [BR:psh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Psest_3257
Peptidoglycan biosynthesis and degradation proteins [BR:psh01011]
 Precursor biosynthesis
  Amino acid ligase
   Psest_3257
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3425190..3426134)
Genome map
AA seq 314 aa AA seqDB search
MSALHSIRDPKTFGRVAVLFGGKSAEREVSLKSGAAVLAALQEAGVDAFGIDAGDDLLQR
LSNEPIDRAFIVLHGRGGEDGSMQGLLECAGIPYTGSGILASALAMDKLRTKQVWQSLGL
PTPQHAVLASEGDCRAAAETLGFPLIVKPAHEGSSIGMAKVGALAELIDAWRAASSYDSQ
VLVEQWIQGPEFTVAVLHGQVLPPIGLGTPHSFYDYDAKYLASDTQYRIPCGLDAAREDE
LKALSARACEAVGIRGWARVDVMQDAAGNFWLLEVNTVPGMTDHSLVPMAARAAGLDFQQ
LVLSILDDSLEAGS
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccctgcattcgattcgtgatccgaaaacgttcggccgcgtcgccgtactcttc
ggcggcaagagcgccgaacgcgaagtctccctgaaatccggcgccgcagtgcttgccgcc
ttgcaggaagcaggtgtggacgcctttggcatcgatgcgggtgacgatctgctgcagcgc
ctgagcaacgaaccgatcgatcgtgccttcatcgtcctgcacggccgtggcggtgaggac
ggcagcatgcagggactgctggagtgcgcgggcattccctacaccggcagcggcatcctg
gcctcggcgctggccatggacaagctgcgcaccaaacaggtctggcagagccttggcctg
ccaacgccgcaacatgccgtgctggctagcgagggcgattgccgggctgcggccgaaacg
ctcggctttccactgatcgtcaagccggcgcatgaaggctcgagcattggcatggccaag
gttggtgcactcgccgaactgattgacgcgtggcgtgctgccagtagctacgactcgcaa
gtgctggtcgagcagtggatccagggcccggagttcaccgtggccgtgttgcatggccag
gtgctgccgccgattggcctgggcacaccgcacagcttctacgactacgacgccaagtac
ctcgcgtccgatacccaataccggattccctgcggcctggacgccgcgcgtgaagacgag
ctcaaggctctctcggcccgcgcctgtgaggcggtcggtatccgcggttgggcgcgggtc
gatgtcatgcaggacgccgccggaaatttctggctgctggaagtgaataccgtgcccggc
atgaccgatcacagcctggtgccgatggcggcacgcgctgctgggctggatttccagcag
ctggttctgagcattctcgatgacagcctcgaggcggggagctag

DBGET integrated database retrieval system