KEGG   Plesiomonas shigelloides: SAMEA2665130_2115Help
Entry
SAMEA2665130_2115 CDS       T04378                                 

Gene name
yeaD
Definition
(GenBank) Putative glucose-6-phosphate 1-epimerase
  KO
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
pshi  Plesiomonas shigelloides
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pshi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAMEA2665130_2115 (yeaD)
Enzymes [BR:pshi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     SAMEA2665130_2115 (yeaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:2333997..2334875
Genome map
AA seq 292 aa AA seqDB search
MMDRFLSLPVIEQLSPSLSLRRNAELDILVIDHPKAQAAVSLQGAQLLLWQPTGQQPVIW
LSEKAAFVSGKALRGGIPICWPWFGRVAQPAHGFARNLPWQLQQHQESDETLSLSLNLTD
SAETDAYWPHAFSLTLEISVGEQLTLSLNSSSNEEVRLTGALHTYFAVGDIGKTSVEALG
SEYTDSLNKGQKVEDAPVLTIEEGEAIDRIYTAAEEASFIHDEANQRVIVVEHQGNNCVV
AWNPGKEGARGMADMADDGYQTMLCVETVLAGTPTIINAQHSHQLLARIRIA
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgatggatcgtttcttatctttgcctgttattgaacaactctccccgtcgttaagcctg
cgccgtaatgcggagctggatatcctggttattgatcaccccaaagcccaagcggccgta
agtctgcaaggcgcacagttgctgttgtggcaaccaacagggcaacaaccggtaatttgg
ctaagcgaaaaggcagcttttgtcagcggtaaagccctgcgtggcggtattcctatctgt
tggccgtggtttggtcgtgttgcccaaccggcgcacggttttgcccgtaacttgccgtgg
caattacaacagcatcaggaaagcgatgagacgctgagcctgagcttaaacctgacggac
agcgcagaaaccgatgcctactggccacatgcgttctcgctgaccttagagatctctgtg
ggcgagcaactgacgctgagtctgaacagtagcagtaatgaagaagtccgtctgaccggt
gctctgcacacctattttgcggtgggtgatatcggtaaaactagcgtagaagcgctcggt
agcgaatacactgatagcctgaataaaggccagaaagtggaagatgcaccggttctgacc
atcgaagagggtgaagccattgaccgcatctacacggccgccgaagaagcctcgttcatc
cacgatgaagccaaccagcgtgtcattgtggttgagcaccaaggcaataactgtgtggta
gcgtggaaccctggcaaagaaggggcgcgcggtatggccgatatggccgatgacggttat
caaaccatgctgtgtgtggaaaccgttctggccggtacaccaaccatcatcaatgcgcag
catagccaccagctgctggcacgtattcgcatcgcctaa

DBGET integrated database retrieval system