KEGG   Pimelobacter simplex: KR76_14555Help
Entry
KR76_14555        CDS       T03528                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
psim  Pimelobacter simplex
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AIY17674
UniProt: A0A0A1DK09
LinkDB All DBs
Position
complement(2965059..2966027)
Genome map
AA seq 322 aa AA seqDB search
MASPAVEIEVESRVVRVSNPDRVYFPEIGATKLDLVEYYLAVGDGIVNALWERPCMLHRF
PKGLDGDKVHQKRLPAGAPDWVETVQLFFPRWKRTADELCVTELASVIWAVQMSTVEFHP
WNSRRGATEQPDEWRIDLDPGPASTYDDIRRVAHVAHEVLDELGAVGYPKTSGSKGLHVY
VRIKPELDHKGVRRAALAFAREVERRAPQLVTTTWWKKDRDPAAVFVDYNQNARDHTIAA
AYSVRGLPDARVSTPIRWDEIDDADPRDFTIRTVPARFAELGDLHHDIDDHVFDLAPLVA
WADRDDLPDEGDEGGESAEGAE
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcccccgcggtcgagatcgaggtcgagagccgggtcgtgcgggtgagcaacccc
gaccgggtgtacttcccggagatcggcgcgacgaagctcgacctggtcgagtactacctc
gcggtcggtgacggcatcgtcaacgccctgtgggagcgcccgtgcatgctgcaccgcttc
cccaaggggctcgacggcgacaaggtgcaccagaagcggctgcccgcgggcgcgcccgac
tgggtcgagaccgtccagctcttcttcccccggtggaagcggaccgccgacgagctctgc
gtgaccgagctggcgtcggtgatctgggccgtccagatgtcgacggtcgagttccacccc
tggaacagccggcgcggcgcgaccgagcagcccgacgagtggcgcatcgacctcgacccc
ggcccggcctcgacgtacgacgacatccgccgggtcgcccacgtcgcccacgaggtgctc
gacgagctgggcgccgtcggctatccgaagaccagcggcagcaagggcctgcacgtctac
gtccggatcaagcccgagctcgaccacaagggcgtacgacgggcggcgctcgccttcgcg
cgcgaggtcgagcggcgcgcgccccagctcgtcaccacgacctggtggaagaaggaccgc
gacccggccgcggtgttcgtcgactacaaccagaacgcccgcgaccacaccatcgcggcg
gcgtactcggtgcgcgggctgcccgacgcccgcgtctcgacacccatccgctgggacgag
atcgacgacgccgacccgcgcgacttcacgatccgcacggtgcccgcgcggttcgccgag
ctcggcgacctgcaccacgacatcgacgaccacgtcttcgacctcgcgccgctggtggcg
tgggccgatcgggacgatctgccggatgagggcgacgagggcggcgagagcgcagagggc
gcggagtag

DBGET integrated database retrieval system