KEGG   Pseudorhodoplanes sinuspersici: CAK95_06770Help
Entry
CAK95_06770       CDS       T04834                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11209  
GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
psin  Pseudorhodoplanes sinuspersici
Brite
Enzymes [BR:psin01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     CAK95_06770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1379697..1380401
Genome map
AA seq 234 aa AA seqDB search
MSSLSAFPITKRWPAKHPDRLQLYSFPTPNGVKVSIALEEIGLPYEAHTVNIGQNESWTP
EFLSLNPNGKIPAIVDPNGPGGKPLGLWESGAILGYLAGKTDKLIPHDPARMIETIQWVH
FQMGGIGPMFGQVGFFHKFAGKDYEDKRPRDRYVNESKRLLGVLEGRLKGRQWIMDDDFT
IADISMLGWVRNLVGFYGARELVEFDNLKEVPAWLERGLARPAVQRGLEIPKRP
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccctctccgcctttcccatcaccaaacgctggcccgccaaacatcccgatcgt
ctgcagctttattcctttccgacgccgaacggtgtgaaggtgtcgatcgcgctggaagag
atcggccttccctacgaggcccatacggtcaatatcggacagaacgagagctggacgccg
gaattcctctcgctcaatccgaacggaaaaatccccgcgatcgtcgatccgaatggtccc
ggcggcaagccgctcggcctttgggaatccggcgcgattcttggctatctcgccggcaag
accgacaaactgatcccgcatgatccggcgcggatgatcgagaccatccagtgggtgcat
ttccagatgggtggcatcggcccgatgttcggtcaggtcggattctttcataagtttgcc
ggcaaggactatgaggacaagcggccgcgcgatcgctacgtcaacgaatcgaagcgcttg
cttggcgtgctcgaaggccgattgaaaggccggcaatggatcatggacgatgacttcacc
atcgccgacatctcgatgcttggctgggtgcgcaatctcgtcggcttctacggcgcgcgt
gagctggtcgagttcgacaatctcaaggaggttccggcctggcttgagcgcggccttgcg
cgaccggcggtgcagcgggggcttgagattccgaagcggccttag

DBGET integrated database retrieval system