KEGG   Pseudorhodoplanes sinuspersici: CAK95_23740Help
Entry
CAK95_23740       CDS       T04834                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
psin  Pseudorhodoplanes sinuspersici
Brite
Enzymes [BR:psin01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     CAK95_23740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: ARQ01771
UniProt: A0A1W6ZXA7
LinkDB All DBs
Position
complement(4883683..4884552)
Genome map
AA seq 289 aa AA seqDB search
MARKAVRSQAKAKSKSSRKLKSSSKKTARTAAGGARKTSASKATKKKARAKPGAGSKQRP
IELHYWPTPNGWKISIMLEECGLPYIMKPVNISTGDQFKPEFLAISPNNRMPAIVDPDGP
GGKPISVFESGAILQYLGRKTGKFYPANERERVEVEQWLMWQMGGLGPMAGQAHHFRHYA
PEQLPYAIDRYTNEVNRLYGVMNTRLKDRPFLAGRYSIADMACVGWASRWERQGQDIAEF
PHFKRWLDTLLARPAVQRGMKLRVEEASKVDMKDPKVYELLFKQRARAG
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgaaaagcagtgagatcgcaggcgaaggccaaatccaaatcgtcacgaaaattg
aaatcctcgtcaaagaagacggctcgcaccgcagctggaggtgcgcgcaagaccagcgca
tccaaagccaccaagaagaaagcgagagcgaagcccggagcaggcagcaaacagcgcccg
atcgagcttcattactggccgacgccgaatggctggaagatttcgatcatgctcgaggag
tgcgggcttccttacattatgaagccggtcaacatctcgaccggcgatcagttcaagcct
gaattcctggccatctcccccaataaccgcatgccggccatcgtcgatccggacggtccg
ggcggcaaaccgatctcggtcttcgagtcaggggcgatcctgcaatatctcggacgcaag
accggcaagttctatcccgccaacgagcgcgagcgcgtcgaagtcgagcaatggctgatg
tggcagatgggaggcctcggtcccatggccgggcaggcgcatcacttccggcactacgca
cccgagcaattgccgtatgcgatcgatcgctataccaacgaggtcaaccgtctctatggt
gtgatgaacacccgtctcaaggatcggccgtttctcgccggccgctattcgatcgccgac
atggcctgcgtcgggtgggcttcgcgatgggagcgccagggacaggacatcgccgagttt
ccgcacttcaagcgctggctcgatacgctgttggcacggccggccgtccagcgcggcatg
aagctgcgcgtggaagaagcctcgaaggtcgatatgaaggatccgaaagtctacgagctg
ttgttcaagcagcgcgcccgcgccggatga

DBGET integrated database retrieval system