KEGG   Pirellula staleyi: Psta_3335Help
Entry
Psta_3335         CDS       T01147                                 

Definition
(GenBank) Exo-alpha-sialidase
Organism
psl  Pirellula staleyi
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(4317776..4319755)
Genome map
AA seq 659 aa AA seqDB search
MDPVARNCHLSSQHSPSSCSIWLGVLLLLVTSVCAAADEPALAPNRHYDGASLDVAEPLV
IGWRSRLPQPSKPPSASAYEASIAPARWKESLSRMHGQPTVIEYASSDSKFRAVRLDGKS
AIWQTAISWGVHAQDFTLVVTLNPYQQDSSGFVFDGSSAAGLIRLYLRDGKWHVGLQKAD
SRANDFPGVPTHTFIAEQWQTHVVRLARRGDVARLTHGISTEKSWSQSSQTIEHAASLAG
LILGTDVATKNGLPVDIAQLQFFERALSDKECEQVAAASLQITRASKLIPAESTSRNDAA
VVPQGVIRPMLRSSQEDGVHTYRIPGLAYTPKGTLLAVFDIRYDSSADLPGNIDVGLVRS
TDQGKTWSKMQTIVDFDKSVPQSRGNGVGDPTILVDREKNVLWVAALWSQGDRAWHGSGP
GLAPEETGQFVLVRSDDEGVTWSKPINITAQVKNPKWRLCFQGPGAGIQTSDGTLIIPAQ
FRDELGAPHSTFIYSRDHGDHWQIAPAAVPTEYPTSEAQIAERSDGSLLLSMRDESRSGW
RSWNVWEWSKTAEKPGLPEGKWSKAWTSVPDPVCMASLISLGGKRMVMASPGSSSHRMGL
TLRLSSDDGQTFSSGYMLDPRGCMYSSMVLLPNDRIGIVYEVRQGLEFATVPLSQLSPE
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atggatccagtagctcgaaattgtcacttgagtagccagcactctccaagcagttgctcg
atatggctcggcgtgttgctgctgcttgtgactagcgtctgtgcagcggcagatgagcct
gcgctcgcgccaaaccgtcactacgacggagcctcgctcgatgtggctgagccgcttgtc
atcggctggcgcagtcggcttccgcagcctagcaagcccccctcagcaagtgcttatgaa
gcgtcgatcgcgccggcgcgctggaaggagtccctctcgcgcatgcatggtcagccgacc
gtgatcgagtatgcaagttcggacagtaaatttcgagccgttcgtctcgatggaaagtcg
gcgatttggcaaaccgccattagctggggagtgcatgcccaagacttcacgctcgttgtc
acgttgaatccctaccagcaggattcctcgggctttgtattcgatggatcgagtgctgcc
ggcttaattcgtctttacctgcgcgatggaaagtggcacgtcggccttcagaaggccgac
agccgcgccaacgattttccaggtgttccgacgcacacgtttatcgccgagcaatggcaa
acgcatgtcgtgcgtcttgcgcggcgcggagatgtggccaggctgacgcacggaatctcc
accgagaaaagttggtcgcaaagttcgcagacgatcgagcatgctgcgtcactcgccggg
ctgattctgggaaccgatgttgcaaccaagaacggcctgcctgtcgatatcgcgcagctt
cagtttttcgagcgagcactcagcgacaaagagtgcgagcaagttgctgcggcttcgctg
caaatcactcgtgcatcgaagctcatcccagcggagtcgaccagtcgaaacgatgctgct
gtggttccccagggagtgattcgtccgatgctccgctcctcgcaagaggatggcgtgcac
acctatcgcattcccgggttggcttacacgccgaagggaacgttgctcgcagtattcgat
atccgctacgacagcagcgccgatcttccgggcaatatcgacgtcggactggtgcggagc
accgatcaaggaaagacttggtcgaagatgcaaacgatcgtcgattttgacaagtccgtt
ccgcaatcgcgcggcaatggagtgggcgatccaaccatcctggtcgatcgtgagaaaaac
gtcctttgggtagcggctctttggtcgcaaggggatcgcgcttggcatggttcagggcca
ggcttggcacctgaggaaacggggcaattcgttttagttcggagcgacgacgaaggggtc
acgtggtcgaagccgatcaacatcaccgcgcaggtcaaaaacccgaagtggcgtctctgt
tttcaaggtcccggagctggcattcaaaccagcgatggcacgctaatcattcctgcccag
tttcgcgacgaactgggtgccccgcattcgacgttcatctacagccgcgatcatggcgac
cactggcaaattgcccccgccgctgttccgaccgaatatcccaccagcgaagcgcaaatc
gccgagcgctccgacggttccctgctcctctcgatgcgcgacgaatcgcgtagtggctgg
cgcagctggaatgtttgggagtggtcgaaaacagccgaaaagcccggcctgcccgagggg
aaatggtcgaaagcgtggacttcggttcccgatcctgtttgcatggcgagtttgatcagc
ctcggtggaaaacggatggtgatggcgagtccgggaagttcctcccatcgcatgggactc
acgctgcgactcagtagcgacgacggtcaaacgttcagcagcggctacatgctcgacccg
agaggctgtatgtatagctcgatggtgctgctgccaaacgaccgcatcggcatcgtctat
gaagttcgacaaggccttgagtttgcgactgtcccgctgagtcaactttcaccggaatag

DBGET integrated database retrieval system