KEGG   Psychrobacter sp. G: PSYCG_11080Help
Entry
PSYCG_11080       CDS       T02715                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  
malate dehydrogenase [EC:1.1.1.37]
Organism
pso  Psychrobacter sp. G
Pathway
Citrate cycle (TCA cycle)
Cysteine and methionine metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Glyoxylate cycle
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:pso00001]
   00020 Citrate cycle (TCA cycle)
    PSYCG_11080
   00620 Pyruvate metabolism
    PSYCG_11080
   00630 Glyoxylate and dicarboxylate metabolism
    PSYCG_11080
  Energy metabolism
   00680 Methane metabolism
    PSYCG_11080
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    PSYCG_11080
Enzymes [BR:pso01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     PSYCG_11080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2546313..2547302)
Genome map
AA seq 329 aa AA seqDB search
MSMKQPVRVAVTGAAGNISYAMLFRIASGEMLGKDQPVILQLLEIAPALDALKGVVMELE
DCAFPLLAGVVQTDDATVAFKDVDYALLVGSRPRGPGMERKDLLEANAAIFSAQGKALND
VASRDVKVLVVGNPANTNAVIAQRNAPDLDPRNFTAMTRLDHNRAMAQLAGKTDSTVNDL
KKMIIWGNHSSTQYPDLTASTVNGKPALDLVDRAWYEGTYIPEVQQRGAAIIKARGASSA
ASAANAAIAHVRTWVMGTDENDWVSMGVYSNGEYGIAKGLIYSFPVTCANGDWSIVDGVD
VSSDFSKEKMAATEQELSEERDAVAHLLP
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatgaaacagcctgtacgcgttgccgtgactggtgccgctggtaatatcagctat
gctatgttatttcgtattgcttctggcgagatgctaggtaaagatcagccagtgattctg
caattacttgaaatcgctccagcacttgatgccctaaagggtgtggtcatggaattagaa
gactgtgcattcccattattggctggtgtcgtccaaactgatgatgcgactgtggctttt
aaagatgtcgattatgcgttactcgtaggctcacgccctcgtggtcctggtatggaacgt
aaggatttgctagaagccaatgctgcgattttctcagcgcaaggtaaagcattgaatgat
gttgcaagccgtgatgttaaagtattagtagtaggtaatcctgctaacaccaacgctgtt
atcgctcagcgtaacgcaccggatttagatccacgtaacttcactgccatgactcgccta
gatcataaccgtgcaatggcacagttagctggcaagactgacagcacggttaatgacttg
aagaaaatgatcatctggggtaaccattcatcaactcagtatcctgatttgacggcgagc
actgtaaatggcaaaccggcgttagacttggttgatcgcgcatggtatgaaggtacttat
atcccagaagtacaacaacgtggcgctgcaatcatcaaagcacgcggtgcatcatctgcc
gcttctgctgccaatgctgctatcgcacacgtacgtacgtgggtaatgggtactgatgag
aatgattgggtatctatgggtgtctattcaaacggtgagtatggtattgctaaaggtttg
atttactcattcccagtaacttgtgctaacggcgattggtctatcgtagatggcgttgat
gtgtcatcagatttctcaaaagagaaaatggcagccactgagcaagagctgagcgaagag
cgtgatgcagtagcacacttattaccgtaa

DBGET integrated database retrieval system