KEGG   Phytophthora sojae: PHYSODRAFT_353780Help
Entry
PHYSODRAFT_353780 CDS       T03459                                 

Definition
(RefSeq) hypothetical protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
psoj  Phytophthora sojae
Pathway
psoj00250  Alanine, aspartate and glutamate metabolism
psoj00410  beta-Alanine metabolism
psoj00430  Taurine and hypotaurine metabolism
psoj00650  Butanoate metabolism
psoj01100  Metabolic pathways
psoj01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psoj00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    PHYSODRAFT_353780
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PHYSODRAFT_353780
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PHYSODRAFT_353780
   00430 Taurine and hypotaurine metabolism
    PHYSODRAFT_353780
Enzymes [BR:psoj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     PHYSODRAFT_353780
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC UPF0052 DUF465
Motif
Other DBs
NCBI-GeneID: 20649464
NCBI-ProteinID: XP_009518027
JGI: Physo3_353780
UniProt: G4YNZ2
LinkDB All DBs
Position
Unknown
AA seq 493 aa AA seqDB search
MQVNTRKYSGDAGDLPLETEAVYGHPLMCASLPSDVFPQRSVPARVAHQLIKDELALDGN
PKMNLASFVTTYMEPEAEDLMVEGLRKNYIDLDQYPQTAEIHNRCVTMLANLYHAPLEPG
QKATGTGCIGSSEAIMLAGLAMKRRWKDRRIAAGLPYDKPNMVFGSNVQVCWHKMCKYFE
IEIREADVSPDCLVLTAKRARALIDENTIGVSAILGSTFNGEYEDVKSIHDMLVEENERN
GWNIPLHVDAASGGFIAPFISPELEWDFRLPNVKSINVSGHKFGLVYAGMGWALWREPED
LPDDLVFHVNYLGGDQSSFTLNFSKGAGNVVAQYYNMLRFGFEGYRRIMEASMENAQLLR
GALVATGHFRIVDKQHMPLVAFALIDSSRYTCFDIQDKLKSRGWIVPAYTCSSGAESLTI
MRVVVKQNFSSHMANMLVQDILKAIEALEQHHVLVDTAMSSPKAQKKHFKDIVHALQANL
KHQQSGLTTHGVC
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtgaacacgcgcaagtactcgggcgacgctggcgacctgccgctggagacggag
gccgtgtacggccacccgctcatgtgcgccagcctgccgtccgacgtgttcccgcagcgc
tcggtgcccgcgcgcgtggcgcaccagctcatcaaggacgagctggcgctggacggcaac
cccaagatgaacctggcgtccttcgtgaccacgtacatggagcccgaggccgaggacctg
atggtcgagggcctgcgcaagaactacatcgacctggaccagtacccgcagacggccgag
atccacaaccgctgcgtcacgatgctggccaacctgtaccacgcgccgctggagcccggc
cagaaggccacgggcacgggctgcatcggctcgtccgaggccatcatgctggccggcctg
gccatgaagcgccgctggaaggaccgccgcatcgccgcgggcctgccgtacgacaagccc
aacatggtcttcggctcgaacgtgcaggtctgctggcataagatgtgcaagtacttcgag
atcgagatccgtgaggccgacgtgtccccggactgcctcgtgctcacggccaagcgcgcg
cgcgccctcatcgacgagaacacgatcggcgtcagcgccatcctgggcagcaccttcaac
ggcgagtacgaggacgtcaagagcatccacgacatgctcgtggaggagaacgagcgcaac
ggatggaacatcccgctgcacgtggacgcggccagcggcgggttcatcgcgccgttcatc
agccccgagctggagtgggacttccgtctgcccaacgtcaagagcatcaacgtgagcggc
cacaagttcggcctcgtgtacgccggcatgggctgggccctgtggcgcgagcccgaggac
ctcccagacgacctggtgttccacgtcaactacctgggcggagaccagtcgtccttcacg
ctcaacttctccaagggcgcgggcaacgtggtggcccagtactacaacatgctgcgcttc
ggcttcgagggataccgtcgcatcatggaggccagtatggagaacgcgcagctactgcgt
ggagcgctggtggccacgggccacttccgcatcgttgacaagcagcacatgccgctcgtg
gccttcgcgctgattgactcgtcgcgctacacgtgcttcgacatccaggacaagctcaag
agccgcggctggattgtacctgcctacacgtgctccagcggtgccgagtcgctgacgatc
atgcgcgtggtggtgaagcagaacttctcgtcgcacatggccaacatgctggttcaggac
atcctaaaggctattgaagcgctggagcagcaccacgttctcgtggacaccgccatgtcg
tcacccaaggcgcagaagaagcacttcaaggacattgtgcacgcgctccaggccaacctc
aagcaccagcagtcgggtctcacgacgcacggcgtgtgctag

DBGET integrated database retrieval system