KEGG   Phytophthora sojae: PHYSODRAFT_539206Help
Entry
PHYSODRAFT_539206 CDS       T03459                                 

Definition
(RefSeq) superoxide disumtase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
psoj  Phytophthora sojae
Pathway
Peroxisome
Brite
KEGG Orthology (KO) [BR:psoj00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    PHYSODRAFT_539206
Enzymes [BR:psoj01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     PHYSODRAFT_539206
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 220 aa AA seqDB search
MLASRVFSAARRAAGTRSIATVKLPDLAYDFGALEPSISGQIMEIHHQKHHQTYVNNYNA
ALEQYAEAEAKGDHAKLLSLLPALKFNGGGHVNHSIFWTNLAPANENGGGEPEGELRKAI
DQEFGSFDNFKKTMAAKSVGVQGSGWGWLGYSPETKRVGVVTTPNQDPCSTTGYVPLLGI
DVWEHAYYLQYKNVRPDYLNAIWDVVNWKNVEERYLVAKK
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgcttgcctcccgtgtgttctcggccgcccgccgcgccgccggcacgcgctccatcgcg
accgtgaagctgcccgacctcgcctacgacttcggcgccctggagccgtccatctcgggc
cagatcatggagatccaccaccagaagcaccaccagacgtacgtcaacaactacaacgcc
gcgctcgagcagtatgccgaggccgaggccaagggcgaccacgccaagctgctgagcctg
ctgccggcgctcaagttcaacggcggcggccacgtgaaccactccatcttctggaccaac
ctggcgcccgccaacgagaacggcggcggcgagcccgagggcgagctgcgcaaagccatc
gaccaggagttcggcagcttcgacaacttcaagaagaccatggccgccaagtccgtgggc
gtgcagggctcgggctggggctggctgggctactcgcccgagaccaagcgcgtgggtgtc
gtcacgacccccaaccaggacccgtgcagcaccacgggctacgtgccgctgctgggcatt
gacgtgtgggagcacgcctactacctgcagtacaagaacgtccgcccggactacctgaac
gccatctgggacgtggtcaactggaagaacgtggaggagcgctacctcgtggccaagaag
taa

DBGET integrated database retrieval system