KEGG   Pseudomonas sp. Os17: POS17_4277Help
Entry
POS17_4277        CDS       T04177                                 

Definition
(GenBank) peptide synthase
Organism
psos  Pseudomonas sp. Os17
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(4826943..4839959)
Genome map
AA seq 4338 aa AA seqDB search
MTDAFELPSTLAQALQRRAVLAPDQVALRFLAQEQEQSVVLSYRDLDLRARTIAAALQAN
AEFGDRAVLLFPSGPDYVAAFFGCLYAGVIAVPAYPPESTRHHHQERLLSILADAEPRLL
LTSAGLRDSLLQMDELQAAGAPQLLCVDTLDPALAQDWQAVELKDQDIAFLQYTSGSTAL
PKGVQVSHGNLVANELLIRRGFGIDLNPDDVIVSWLPLYHDMGLIGGLLQPIFSGVPCVL
MSPAYFLARPVRWLEAISEYGGTISGGPDFAYRLCSERVSESALERLDLSRWRVAYSGSE
PIRLDTLERFAETFAPCGFSADNFLASYGLAEATLFVAGGVRGQGIPALHLDDRALAQNR
AEPGQGSAMMSCGFSQPEHAVLLMDPQQLTELPDNRIGEVWASGPSIAHGYWRNPEATAK
TFVQHAGRTWLRTGDLGFMRDGELFITGRLKDLLIVRGHNLYPQDIEKTIEREVEVVRKG
RVAAFAVSDQGQEGIGIAAEISRSVQKILPPEALIKAIRQAVAEACQEAPSVVVLLNPGA
LPKTSSGKLQRSACRTRLADGSLDHYALFPQAEAAPAGVQDASDDALQNLIGRIWQEHLQ
CAAVAADDHFFLLGGNSIAATQVTARLREELGLELSLRLLFEAPTLGAFTAAVARQQQDG
GVAQGSIQALSRQQPLPQSLAQNRLWITWQLDPHSSAYNIPGGLRLRGELDEDALRASFQ
HLLQRHEALRTRFFERDGQALQQVDAAGEFNLQVIDISDLPVAEREARAQQIREDEARTQ
FDLEKGPLYWATLIRLDDEEHQLLLTLHHIIADGWSLTVLIDEFSRLYAAAAQGQRLELA
PLALQYADYGSWQRQWLAQGEGQRQLDYWKQQLADEAPVLSLATDHPRSAQVRHSAARHS
QRLGVNLSETVRQTAQAWQVTPFMLLLATFQTLLHRYSGQTEIRIGVPNANRPRLETQGL
LGFFINTQVLRGQLEARQTFAELLQQTRRTVLEAQAHQDLPFEQLLEAFPDAREQGLFQV
MFNHQQRDLSALRRLPGLLAEELPWHSREAKFDLQLHSEEDRNGRLSLAFDYADELFDAA
TIERLAGHFISLLEQACQQPDCALGDLPLLGKVEAAQLQQWSMAPCARAERWLPERLQEQ
LQRTPERTALVWDGGQLSFAELHAQANRLAHYLRDKGVGPDVCVAIAAERSPQLLIGLLA
IIKAGGAYVPLDPDYPAERLAYMLADSGVQLLLTQTQLLGQMPEAPGVSAIAMDGLKLDS
WPSHAPGLHLDGDHLAYVIYTSGSTGQPKGVGNTHRALMERLQWMQDSYQLQADDVLMQK
APISFDVSVWECFWPLITGCRLLLAAPGEHRDPHRIAQLVQEFGVTTLHFVPPLLQLFVD
EPLSAECHSLRRVFSGGEALSAELRNRLLQQLPNAQLHNRYGPTETAINVTHWQCSVEDG
ERSPIGRPLGNVLCRVLDAELNLLPAGVPGELCISGQGLARGYLGRPALTAERFVVDPLG
EEGARLYRTGDRVRWCADGALEYLGRLDQQVKLRGFRVEPQEIEARLLAQDGVAQAAVLV
RDSVAGPQLIGYYTAPASDEDETEQRARLTAALAAELPEYMVPAQLLRLDAMPLSPSGKL
DRRALPEPQWQVREHVEPSTDLERQIAAIWRDVLGQPRIGLKDDFFALGGHSLLATQIIS
RTRQACDVELPLRVLFEASELGAFAEQVRLIQQSGARNQQPPIARVDRSQPVPLSYSQQR
MWFLWQMEPDSPAYNVGGMARLSGVLDVGRFEAALQALILRHETLRTTFPSINGVAHQQV
HADTGLRMAWKDFSALAPEARQQRLQQLADSEAHQPFDLETGPLLRACLVKAGEQEHYFV
LTLHHIVTEGWAMDIFARELSALYEAFLDDRESPLQPLPVQYLDYSVWQRQWLESGERQR
QLDYWTGQLGREHPLLELPSDRPRPAVQSHQGELYRFDLSDELAARVRAFNAEHGLTLFM
TMTAALSVLLYRYSGQTDLRIGAPVANRIRPESEGLIGAFLNTQVLRCQLDGQMSVGQLL
EQVRHTVIEGQSHQDLPFDHLVEALQPPRSAAYNPLFQVMCNVQRWEFQQSRQLAGMTVD
YLVNDARATKFDLNLEVTDLDQRLGCCLTYSTDLFDEPRIARMAGHWRNLLQALIDDPQR
RLCELPLLHAEEQQQLLDSLSVEPGEQRLDQCIHHLFSEQALARRDAPALTFAGQTLSYS
ELDSRANRLAWMLRERGVGPQVRVGLALERSLDMVVGLLAILKAGGAYVPLDPEYPLDRL
HYMIEDSGLGLLLSDARMFAALGELPTGVGRWCLEEDGALLADYPASELPFISLPQHQAY
LIYTSGSTGQPKGVVVSHGEIAMHCQAVIRRFGMRPDDCELHFYSINFDAATERLLAPLL
SGAQVVLRAQGQWDAEEICQLIRQHRISILGFTPSYGSQLAQHLATQQQTLPVRMCITGG
EALTGEHLQRIRAAFQPSLFFNAYGPTETVVMPLASLAPEHLAEGVASVPIGRIVGARVA
YILDADLALVPQGATGELYVGGAGLAQGYHRRPGMSAERFVADPFSGDGGRLYRTGDLVR
QCADGQLEYIGRVDHQVKIRGFRIELGEIETRLLDHPAVREAVVLALDTPAGKQLAGYLV
SEVAEHNEAQQANLREALKQQLKTQLPDYMVPTHLILLDSMPLTANGKLDRRALPMPDPE
LNRQQYVAPSNELEQTLAKVWGEVLNVRQVGLNDNFFELGGDSILSIQVVSRARQLGLHF
TPRDLFQHQTVQTLARVASHTQRVSAEQGPLSGEAPLTPIQHWFFDSRIPQPQHWNQALL
LEPLGLLDAQTLEQALLAVLEQHDALRLRFKPVDGQWRAEYLPLSDVPVLWQVRVPSMAT
CEALFADAQRSLDLEHGPLLRAVLVDGPEGEQRLLLAIHHLVVDGVSWRVLLEDLQNAYR
QLQAGQSLKLPAKTSALRDWSSRLQAYAGSESLREELGWWQQQLAGPAAQLPGLNAAGSQ
QHQQARCHSVTLDAERTRQLLQQAPAAYRTQVNDLLLTALARVLCRWSGQPSALVQLEGH
GREALFDEIDLTRSVGWFTSAYPLRLTPLQVEDAAGQGASIKAIKEQLRAVPHKGLGYGV
LRYLADDACREALAALPLAPVTFNYLGQFDQSFGADALLRPLDESVGPTHAPEAPLPNEL
SIDSQVYGGELVLRWTYSGERFAAELIGELADAYLGELQGLIAHCLKDDAGGLTPSDFPL
ARLTQAQLDGLPVPAGQIEDVYPLTPMQEGMLLHTLLEPGTGLYYMQDRYRINSELDPER
FAQAWQAVVARHEALRASFCWNVGEDMLQVIHKPGRTPIEFLDWSAVPEAEQEPKLQALH
KQEREAGFDLLNQAPFHLRLIRVGAARYWFMMSNHHILIDAWCRSLLMNDFFEIYTALGE
GREVQLAVPPRYRDYIGWLQHQSLSEARQWWRQNLEGFERTTPIPSDRPFLREHAGDSGG
MIVGDCYTRLDARDGAQLRELAQQHQLTVNTFAQAAWALVLRRMSGDRDVLFGVTVAGRP
VQMPEMQRTVGLFINSIALRVKLPEEGQRYSVRQWLGDLLDRNMQLREYEYLPLVAIQEC
SELPKGQPLFDSLFVFENAPVEVSVLDRAQSLNASSDSGRTHTNFPITAVCYPGDDLGLH
LSYDQRYFEQATIERLLGEFKRLLLALMQGLHGDMADLPLLGEEEQDFLLAGCNQSQHEY
PLERSYVELFEARVAAHPQRIAASCLEQRYSYAELNQCSNRLGHALIANGVGFDQPVALL
AERGLELLGMIIGSFKAGAGYLPLDPGLPSQRLGRIIELSRTPILVCTAACREQAQALLD
EFACAARPRLLVWEELQGAGHAESNPGRYSAPDNLAYVIYTSGSTGLPKGVMVEQRGMLN
NQLGKVPYLHLSEADVIAQTASQSFDISVWQFLAAPLFGARVDIVPNAIAHDPQGLLAHV
QEQGITVLESVPSLIQGMLAQDAIALDGLRWMLPTGEAMPPELAHQWLLRYPQIGLVNAY
GPAECSDDVAFFRVDLASTRGAYLPIGTPTDNNQLYLMDEALALVPLGAVGELCVAGTGV
GRGYVSDPLRTALAFVPHPFGAAGERLYRTGDLARRRSDGVLEYVGRIDHQVKIRGYRIE
LGEIEARLHEQPEIRDAAVAVQEGVNGKHLVGYLVASDSSLSPSECLERIKPRLRAELPE
YMVPPHWLWLPRLPLNANGKLDRKALPALEIGQLQSQDYQAPGSELEQTLADIWAEVLKV
ERVGVRDNFFELGGHSLLATQIASRVQKTLQRNVPLRAMFECSTVQELAAYIDGLGANEI
SEEKVDRLSDLMAELEGL
NT seq 13017 nt NT seq  +upstreamnt  +downstreamnt
atgacggacgcgttcgaactccccagcaccctggcccaagcccttcaacgccgggcggtc
ctggcccctgatcaagtggcgttgcggttcctcgcccaagagcaggagcagagcgtggtg
ctcagctaccgggacctggatcttcgcgcgcggaccattgccgcggccctgcaagccaac
gctgaattcggcgaccgcgcggtgctgctgttccccagtggcccggactacgtcgcagcg
ttcttcggttgcctgtacgccggggtgatcgcggtgccggcctacccgccggagtcgacc
cggcaccatcaccaggagcggctgctctcgatcctggccgacgccgagccacggttgctg
ctgaccagcgccgggctgcgcgactcactgttgcagatggacgaactgcaggccgccggg
gcgccgcaactgctctgcgtcgacaccctggaccccgcgctggcgcaggactggcaggcg
gtggaactcaaggaccaggacatcgccttcctgcagtacacctccggttccactgcgctg
cccaagggcgtgcaggtcagccacggcaatctggtggccaacgaacttttgatccggcgc
ggttttggcatcgacctcaacccggacgacgtgatcgtcagctggctgccgctgtaccac
gacatgggcctgatcggcggcctgctgcagccgatcttcagcggcgtgccctgcgtgctg
atgtcgccggcctacttcctggcccgccccgtgcgctggctggaagcgatcagcgaatac
ggcggcaccatcagcggcggcccggatttcgcctaccgcctgtgcagcgagcgggtcagc
gaatcggccctggagcgtctcgacctcagccgctggcgcgtggcctattccggttccgag
ccgatccgcctcgacaccctggagcgctttgccgaaaccttcgccccctgcggtttcagt
gccgacaatttcctcgcttcctacggcctggccgaagccaccctgttcgtcgccgggggc
gtgcgcggccagggcatcccggccctgcacctggacgaccgggccctggcgcagaaccgc
gccgagccggggcagggcagcgcgatgatgagttgcggcttcagccagcctgagcacgcc
gtgctgctgatggatccgcagcagctcacggaattgcctgacaaccgcatcggcgaagtc
tgggccagcggaccgagcatcgcccacggctactggcgcaatcccgaagccacggccaag
accttcgtccagcatgccggccgcacctggctgcgcaccggcgacctgggcttcatgcgc
gacggcgagctgttcatcaccgggcgcctgaaggacctgctgatcgtgcgcgggcacaac
ctgtatcctcaggacatcgaaaagaccatcgagcgcgaagtggaagtggtgcgcaagggc
cgggtggcggcgttcgcggtcagcgaccagggccaggaaggcatcggcatcgccgcggaa
atcagccgcagcgtgcagaagatcctgccccccgaagcactgatcaaggccatccgccag
gcagtggccgaagcctgccaggaagcgcccagcgtggtggtactgctcaaccccggggcc
ctgccgaagacctccagcggcaagttgcagcgttccgcctgtcgcacccggctggccgat
ggcagcctggatcactacgcgctgttcccccaggccgaggctgcacccgccggcgttcag
gacgcgtccgacgacgcgctgcaaaacctgatcgggcgaatctggcaggagcacctgcaa
tgcgccgccgtggccgccgacgatcacttcttcctcctgggaggcaactcgatcgccgcc
acccaggtcacggcccgcctgcgcgaggaactgggcctggaactgagcctgcggctgttg
ttcgaagcgccgaccctgggcgccttcaccgccgccgtggcgcgtcagcaacaggacggc
ggcgtggcccagggcagcatccaggccctgtcgcgccagcagccgctgccccaatccctg
gcacagaaccgcctgtggatcacctggcaactggacccccacagcagcgcctacaacatt
cccggtggcctgcgcctgcgcggcgagctggacgaagacgccctgcgcgccagcttccag
cacctgctgcagcgtcacgaagcgctgcgcacgcggttcttcgaacgcgacggccaggcc
ctgcaacaggtggacgcggccggtgagttcaacctgcaggtgatcgacatcagcgatctg
cctgtggccgagcgtgaagcccgggcgcagcagattcgcgaagacgaggcccgcacccag
ttcgacctggaaaagggcccgttgtactgggcgaccctgatccgcctggacgacgaagaa
catcaactgctgctgaccctgcaccacatcatcgccgacggctggtcgctgactgtgctg
atcgacgagttctcccggctctacgccgccgcggcccagggccagcgcctggagctggcg
cccctggccctgcaatacgccgactacggcagctggcagcgccagtggctggcccagggc
gaaggccagcgccagctggactactggaagcagcaactggccgatgaggccccggtactc
agcctggccaccgaccacccgcgttcggcccaggtccgccacagcgccgcgcgccacagc
cagcgcctcggcgtgaacctcagtgaaaccgtgcgtcagaccgcccaggcctggcaggtc
acgccgttcatgctgttgctggccaccttccagaccctgctgcaccgctacagcgggcag
accgagatccgcataggcgtgcccaacgccaaccgtccgcgcctggaaacccagggcctg
ctgggcttcttcatcaacacccaggtgctgcgcggccaactggaggcgcgccagaccttc
gccgagttgctgcaacagacccgccgcaccgtccttgaggcccaggcgcatcaggacctg
cccttcgaacaactgctcgaagccttccccgacgctcgtgagcaaggcctgttccaggtc
atgttcaaccaccagcagcgcgacctcagcgccttgcgccgtctgccggggctgctggcc
gaagagctgccgtggcacagccgcgaggccaagttcgacctgcaactgcacagcgaggaa
gaccgcaacggccgcctgagcctggccttcgactatgccgacgagctgttcgatgcagcg
accatcgagcgtctggccgggcacttcatcagcctgctggagcaggcctgccagcagccg
gactgcgccctgggtgatttgccgttgctcggcaaggtcgaagcggcgcaattgcagcaa
tggagcatggccccctgcgcgcgcgccgagcgctggttgccggagcgcctgcaggaacaa
ctgcagcggactccggagcgcaccgcgctggtgtgggacggcgggcaactgagctttgcc
gaactgcacgcccaggccaaccgcctggcccattacctgcgggacaagggcgtcggcccg
gacgtgtgcgtggccatcgccgccgagcgttcgccgcaactgctgatcggcctgttggcg
atcatcaaggctggcggcgcctacgtgcccctggacccggattaccccgccgagcgcctg
gcctacatgctcgccgacagcggcgtgcaactgctgctgacccagacccagctgctcggc
cagatgcccgaagccccgggcgtcagcgccatcgccatggacggcctcaagctcgacagc
tggccgagccacgccccgggcctgcacctggacggcgaccacctggcctacgtgatctac
acctccggttccaccggccagcccaagggcgtgggcaacacccatcgtgccctgatggag
cgcctgcaatggatgcaggacagttaccagctgcaagccgacgatgtgctgatgcagaag
gcccccatcagcttcgacgtgtcggtgtgggagtgcttctggccattgatcactggctgc
cgcctgctgctcgctgcccccggcgagcaccgcgacccgcaccgcatcgcccaactggtt
caggagttcggcgtgaccacgctgcacttcgtgccgccgctgttgcagctgtttgtcgat
gaaccgctgagcgccgaatgccacagcctgcgccgggtgttctccggtggcgaagccttg
tccgccgagctgcgcaaccgcctgctgcagcagttgccgaacgcgcaactgcacaaccgt
tacggcccgacagaaaccgcgatcaacgtcacccactggcagtgttcggtggaggacggc
gagcgttcacccattggccggccgctgggcaatgtgctgtgccgggtgctggatgccgag
ctcaacctgctgcccgccggggttccgggcgagctgtgcatcagcggccagggcctggcc
cggggttacctgggacgcccggcgctcaccgccgaacgctttgtggtcgacccgctgggc
gaagagggcgcacgcctgtaccgcaccggtgaccgggtgcgctggtgcgccgacggcgcc
ctggaatacctcggccgcctcgaccagcaggtcaagctgcggggttttcgggtcgagccg
caggaaatcgaagcacggctgctggcccaggacggcgtggcccaggccgcggtgctggtg
cgcgacagcgtcgccggcccgcagttgatcggctactacaccgcccctgccagcgacgaa
gatgaaaccgagcaacgcgcccggctgaccgccgccctggccgccgagttgccggagtac
atggtgccggcgcaactgctgcgcctggacgccatgcccctgagccccagcggcaagctc
gaccgccgcgccttgccggagccgcagtggcaggtgcgcgagcacgtcgaaccgagcacc
gatctggaacggcagatcgccgccatctggcgcgacgtgctgggccagccccggatcggc
ctcaaggacgacttcttcgccctgggcgggcattcgctgctggctacccagatcatttcc
cgcacccgtcaggcctgcgatgtcgagctgccgctgcgggtgctgttcgaagccagcgaa
ctgggggcctttgccgaacaggtgcggctgatccagcaatccggcgcgcgcaaccagcag
ccgccgattgcccgggtcgaccgcagccagccggtgccgctgtcctactcccagcagcgc
atgtggttcctctggcagatggagcccgacagcccggcctacaacgtcggcggcatggcg
cgcttgtctggcgtgctggacgtggggcgcttcgaggccgcgttgcaggcgttgatcctg
cgccacgaaaccctgcgcaccaccttccccagcatcaacggcgtggcccaccagcaggtg
catgccgacaccggcctgcgcatggcctggaaggatttctcggccctggctccggaggcc
cggcaacaacgcctgcaacagctggcggacagcgaagcccaccagcccttcgacctggaa
accggccccttgctgcgcgcctgcctggtcaaggccggggagcaggagcactacttcgtc
ctgaccctgcaccacatcgtcaccgaaggctgggccatggacatctttgcccgcgaattg
agcgcgctgtacgaagccttcctcgacgaccgcgaatcgcctctgcaacccttgccggtg
cagtacctggactacagcgtgtggcagcgccagtggctggaatccggcgagcgccagcgc
cagctggattactggaccgggcaactgggccgcgaacacccattgctggaactgcccagc
gaccggccacggccggcggtgcaaagccaccagggcgagctgtaccgcttcgacctgagc
gacgagctggcggcccgggtgcgggctttcaatgccgaacacggcctgaccctgttcatg
accatgaccgcggccctgtcggtgctgctctatcgctacagcggccagaccgacctgcgc
atcggcgcgccggtggccaaccgtatccgcccggaaagcgaagggctgatcggcgccttc
ctcaacacccaggtgctgcgttgccagctcgacgggcagatgagcgtcggccagttgctg
gagcaggtgcgccatacggtgatcgagggccagtcgcaccaggacctgccgttcgaccat
ctggtggaagccttgcagccgccgcgcagcgccgcctacaacccgctgttccaggtgatg
tgcaacgtccagcgctgggagttccagcaaagccggcaactggcgggcatgaccgtggac
tacctggtcaacgatgcccgggccaccaagttcgacctcaacctggaagtcaccgacctg
gatcagcgcctgggttgctgcctgacctacagcaccgacctgttcgacgagccgcggatt
gcgcgcatggccggccattggcgcaacctgctgcaggctctgattgacgatccgcagcgg
cgcttgtgcgaactgccgctgctgcacgccgaggaacagcaacagctgctggacagcctg
agcgtcgagcccggtgagcaacgtctggatcagtgcatccatcacctgttcagcgagcag
gccctggcccgtcgcgacgctccggccctgaccttcgccgggcagaccctgagctacagc
gaactggacagccgcgccaaccgcctggcctggatgctccgcgagcgtggcgtgggcccg
caggtgcgggtcggtctggccctggaacgttccctggacatggtcgtcggcctgctggcg
atcctcaaggccggtggcgcctacgtgcccctggacccggaataccccctggatcgcctg
cactacatgatcgaagacagcggcctcggcctgctgctcagcgatgcacggatgttcgcc
gccctgggtgagttgccgacgggcgtcggccgctggtgcctggaagaagacggcgcgttg
ctggccgactacccggccagcgagctgccgttcatcagcctgccccagcatcaggcgtac
ctgatctacacctccggctccaccggccagcccaagggcgtggtggtgtcccacggggaa
atcgccatgcactgccaggcggtgatccgccgtttcggcatgcgcccggacgactgcgag
ctgcacttctattccatcaacttcgacgccgccaccgagcgtctactggcaccgctgctc
agcggcgcccaggtggtgctgcgggcccagggccagtgggatgccgaagagatctgccag
ctgattcgccagcatcgcatcagcatcctcggcttcacccccagctacggcagccagctg
gcccagcacctggccacccagcagcagaccctgccggtgcgcatgtgcatcaccggcggc
gaggccctgaccggcgaacacctgcagcgcattcgcgcggcgttccagccgagcctgttc
ttcaacgcctacggccccactgaaaccgtggtcatgcccctggccagcctggcgccggag
cacttggccgaaggcgtggccagcgtgcccatcggccgcattgtcggggcgcgggtggct
tacattctcgatgccgatctggcgctggtgccccaaggggcgaccggtgagctgtatgtc
ggcggcgccggcctggcccaggggtatcaccgtcgtccggggatgagcgccgagcgtttc
gtggccgatccgttctccggcgatggcgggcgcctgtaccgcaccggggacctggtgcgc
cagtgcgccgacggtcagctggagtacatcggccgggtcgaccatcaggtgaagattcgc
ggtttccgcatcgagctgggagagatcgaaacccgtctgctggatcatccggccgtgcgt
gaagcggtggtgctggccctggacaccccggccggtaagcagctggccggttatctggtg
agcgaggtggccgagcacaacgaggcgcagcaggccaacctgcgggaagctctcaagcag
cagctgaaaacccaactgccggactacatggtgccgacccacctgatcctgctcgacagc
atgccgctgaccgccaacggcaagctcgaccgccgggccctgccgatgccggacccggag
ctcaaccgccagcagtacgtggcgccgagcaacgagctggaacagaccctggccaaggtc
tggggcgaagtgctgaacgtgcggcaagtgggcctcaacgacaacttcttcgaactgggg
ggcgactcgatcctgtcgatccaggtggtcagccgcgcccgccagctggggctgcacttc
accccgcgggacctgttccagcaccagaccgtgcagaccctggcccgggtcgccagccat
acccagcgcgtcagcgccgagcagggcccgctcagtggcgaagcgccgctgacgccgatc
cagcactggttcttcgacagccgcattccccagccacagcattggaaccaggcattgctg
ctggagccgctgggcctgctcgatgcccagacgctggaacaggcgctgctggcggtgctg
gagcagcacgacgccctgcgcctgcgtttcaaaccggtggatgggcagtggcgcgccgag
tacctgccgctgtccgacgtgcctgtgctgtggcaagtgcgggtgccgtccatggccacc
tgcgaggcactgttcgccgatgcccagcgcagcctcgacctggaacacggaccgctgctg
cgggcggtgctggtggacgggccggaaggcgagcagcgcctgttgctggcgatccaccat
ttggtggtggatggcgtgtcctggcgcgtgctgctggaggatttgcagaacgcctaccgt
cagctgcaagccggacagagcctgaagctgccggccaagaccagcgccctgcgggactgg
tcgagccgcctgcaggcctatgccggcagcgaatccctgcgagaggaacttggctggtgg
cagcagcaactggccggcccggccgcgcaactgccgggcttgaatgccgccggtagccag
cagcatcagcaggctcgctgccacagtgtgactctggatgccgagcgcacccgccaactg
ctgcaacaggccccggctgcctaccgtacccaggtcaacgacctgctgctgaccgccctg
gcccgggtgctgtgccgctggagcgggcagccttcggccctggtgcaactggaaggccac
ggccgcgaggcgctgttcgacgagatcgacctgacccgcagcgtcggctggttcaccagc
gcctatccgctgcgcctgaccccgttgcaagtggaagacgcggccgggcagggcgcctcg
atcaaggccatcaaggaacaactgcgggccgtgccgcacaagggcctgggttacggcgtg
ctgcgctacctggccgatgacgcctgccgcgaggctttggcggcgctgccgctggcgccg
gtgaccttcaactacctggggcagttcgaccagagttttggcgccgatgccttgctgcgt
ccgctggatgaatccgtcggtccgacccatgcacctgaagcaccgttgcccaacgagctg
agcatcgacagccaggtctatggcggcgagctggtactgcgctggacttacagcggcgaa
cgcttcgccgccgaactgatcggtgaactggcggacgcctacctgggcgagctgcagggc
ctgattgcccattgcctgaaggacgatgccggtggcctgacgccgtcggacttccccctg
gcgcgcctgacccaggcccagctcgatggcctgccggtgccggctgggcagatcgaagac
gtctacccgctgaccccgatgcaggaaggcatgctgctgcacaccctgctggagccgggc
accggcttgtattacatgcaggaccgctaccgcatcaacagcgagctggacccggagcgt
ttcgcccaggcctggcaggcggtggtggcgcgccacgaggctctgcgcgcgtcgttctgc
tggaacgtcggcgaagacatgctgcaggttatccacaagccgggccgcaccccgatcgaa
ttcctcgactggagcgcggtgcccgaggccgagcaggaacccaagctccaggccctgcac
aaacaggagcgcgaggccggtttcgatctgctcaaccaggcgccgttccacctgcgactg
atccgcgtcggcgccgcgcgctactggttcatgatgagcaaccaccacatcctcatcgat
gcctggtgccgctcgctgttgatgaacgacttcttcgagatctacaccgccctgggcgaa
ggccgcgaggtgcaactggcggtgccaccgcgctaccgcgactacatcggctggctgcaa
caccagagcctgtccgaggcgcggcagtggtggcggcagaaccttgaaggctttgaacgc
accacgccgatccccagcgaccggccgttcctgcgcgaacacgccggtgacagcggcggc
atgatcgtcggcgactgctacacccgcctggatgcccgggacggcgcgcaactgcgcgag
ctggcgcagcagcatcagctgaccgtcaacaccttcgcccaggcggcctgggccctggtg
ctgcggcgcatgagcggcgatcgcgacgtattgttcggggtcaccgtggctgggcgcccg
gtgcagatgccggagatgcaacgcaccgtcggcctgttcatcaacagcatcgcgctgcgg
gtcaagctgcccgaggagggccagcgttacagcgtgcgccagtggctcggcgacctgctc
gaccgcaacatgcaactgcgtgaatacgaatacctgccgctggtggcgattcaggaatgc
agcgagctgcccaagggccagccgctgttcgacagcctgttcgtgttcgaaaacgccccg
gtggaagtctcggtgctggaccgcgcccagagcctgaacgccagttcggattccggccgt
acccacaccaacttcccgatcaccgccgtgtgctacccgggggatgacctgggcctgcac
ctgtcctacgaccagcgctacttcgaacaggcgaccatcgagcgcctgctcggcgagttc
aagcgcctgctgctggcgctgatgcagggcttgcatggcgacatggccgacctgccgctg
ctgggtgaagaggagcaggatttcctgctggccggctgcaaccagagccagcatgagtac
ccgctggagcgcagctacgtggagctgttcgaggcccgggtggcggcccatccgcagcgc
atcgccgccagttgcctggagcagcgctacagctacgccgagttgaaccagtgcagtaac
cgcctgggccatgccttgattgccaacggcgtgggctttgaccaaccggtggccttgctg
gccgagcgcggcctggaactcttgggcatgatcatcggcagcttcaaggccggagccggc
tacctgcccctggacccgggcctgccaagccagcgcctggggcgcatcatcgaactcagc
cgcacgccgatcctggtctgcaccgcggcctgccgcgaacaggcccaggccctgctggac
gagttcgcctgcgccgcacggccacggttgctggtctgggaagaactgcaaggtgccggg
catgccgagagcaacccgggccgctacagcgcgccggacaacctggcctacgtgatctac
acctccggttccaccggcctgcccaagggcgtgatggtggagcagcgcggcatgctcaac
aaccagctgggcaaggtgccgtacctgcacttgagcgaggctgacgtgatcgcccagacc
gcgtcccagagcttcgacatttcggtctggcagttccttgccgcgccgctgttcggtgct
cgggtcgacatcgtgcccaacgccatcgcccacgatccccagggcctgttggctcacgtc
caggagcagggcatcaccgtgctggagagcgtgccgtcgctgatccagggcatgctcgcc
caggacgccatcgccctggatggcttgcgctggatgctgcccaccggcgaggccatgccg
ccggaactggcgcaccaatggctgctgcgttatccacagatcggtttggtcaacgcctac
ggtccggcggaatgttccgatgacgtggccttcttccgcgtggacctggcttcgacccgg
ggcgcctacctgcccatcggcacgcccaccgacaacaaccagctgtacctgatggacgaa
gccctggcgctggtgcccctgggcgcggtcggcgagttgtgcgtggccggcaccggggtc
ggccgcggttacgtcagcgacccgttgcgcaccgcgctggccttcgtgccccatccgttc
ggtgcggcgggcgaacgcttgtaccgcaccggcgacctggcacgccggcgcagcgacggc
gtactggaatacgtcggccggatcgaccatcaagtgaagatccgtggctaccgcatcgag
ctgggggagatcgaagcgcgcctgcacgaacagccggaaatccgcgatgccgccgtggcg
gtgcaggaaggggtcaacggcaagcacctggtgggttacctggtggccagtgactcaagc
ctgagcccgagcgaatgcctggagcggatcaaaccgcgtctgcgcgccgaactgccggaa
tacatggtgccgccgcactggctgtggctgccgcgcttgcccctcaacgccaacggcaag
cttgatcgcaaggccctgccggccctggagatcggccagttgcagagccaggactaccaa
gccccgggcagcgagctggagcagaccctggcggacatctgggccgaggtgctcaaggtc
gaacgggtgggcgtgcgcgacaacttcttcgagttgggcgggcattccctgctggccacg
cagatcgcctcgcgggtacagaaaaccctgcaacgcaacgtaccgctgcgggccatgttc
gaatgcagcacggtgcaggagttggccgcgtacatcgacggtttgggtgccaatgaaatc
agcgaggagaaggtcgaccgcctgagtgacctgatggccgagctggagggcttgtaa

DBGET integrated database retrieval system