KEGG   Pseudomonas savastanoi pv. phaseolicola 1448A: PSPPH_1911Help
Entry
PSPPH_1911        CDS       T00266                                 

Definition
(GenBank) pyoverdine chromophore precursor synthetase
Organism
psp  Pseudomonas savastanoi pv. phaseolicola 1448A
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2216578..2229588
Genome map
AA seq 4336 aa AA seqDB search
MDAFELPDTLAQALQRRALHTPDRLALRFLTDEKDQGLVLTYRDLDLRARTIAAALQRQA
VPGDRATLLFHSGPDYVAAFFGCLYAGVIAVPAYPPESNRRHHQERLLSIIADAEPRLVL
TGSDLQPALLQMDELAAADAPQLLCVDTLDSASADNWQGPQLQADDIAFLQYTSGSTALP
KGVQVSHGNLVANELLIRHGFGIDVNPDDVIVSWLPLYHDMGLIGGLLQPIFSGVPCILM
APAYFLTRPLRWLEAISEYGGTISGGPDFAYQLCSARVSDSALERLDLSRWRVAYSGSEP
IREDSLNAFAEKFASCGFTPDSFMASYGLAEATLYVAGGKRGKGIPSLRLNAQALARNVA
ELGDGQPVMSCGTGQPGHGVLIADPATLQVLDENRIGEVWASGPSIAHGYWRNPEATAKA
FVQHDGQTWLRTGDLGFQRHGELYITGRLKDMLIVRGHNLYPQDIEKVVEREVDVVRKGR
IAAFAVNQDGSEGIGIAAEVSRSVQKILSAEALIKIIRQAVAEAFQEAPSVVVLLNPGAL
PKTSSGKLQRSACRTRLADGSLDSYAVFPANNTTHQNRTLSTGSDLQAQIASVWCEHLQC
EQISADDHFFLLGGNSIVATQVVARLRETLGIDLNLRLLFEAPTLAAFAAQIEALQIAAS
QGDSQTQNAIVRLPGNEHLPQSLAQNRLWFLWQLDPQSSAYNIPGGLYLRGELDTTALRT
SFQRLIERHESLRTRFYEHDGVALQRIDAPGEFHFDTLDISDLPSDERQTRALAIREEQA
RLPFDLQNGPLLRVTLLRLDEEEHQLLVTLHHIIADGWSLNVLIDEFSRLYASAVQGQPL
ELAPLPLRYADYGQWQREWLANGEAERQLDYWKQQLGDEQPTLELSTDRPRSAHQQHSAS
RYSLRLSAELSAAVRNTAQAWQSTSFMLLLAGFQALLHRYSGQTDIRIGVPGANRPRHET
QGLIGFFINTLVLRAQLDPRLPFSTLLAQTRQAALDAQAHQDVPFEQLVEAFPQAREHGL
FQVMFNHQQRDLGALRRLPGLLAEELPWHSREAKFDLQLHSEEDRNGRLNLSFDYADELF
ERDTIVRLARHYVQLLTQVSQQAQVALGDVQLLGADELSEQAQWSAAACTPAHVWLPEML
ERQALQTPERIALVWEGGSLDFASLHAQANRLAHYLRDKGVGPDVKVAIAAERSPQLLIG
LLAILKAGGAYVPLDPDYPIERLAYMLQDSGVELLLTQSHLLGDLPSADGVCTVAMDMLH
LDSWPVSAPGLHLSGDNLAYVIYTSGSTGQPKGVGNTHAALVERLQWMQDTYGLDESDVL
MQKAPISFDVSVWECFWPLITGCRLLLAGPGEHRDPHRIAQLVNEHGVTTLHFVPPLLQL
FVDEPLAQQCTSLRRLFSGGEALPSELRNRVLEHLPGVQLHNRYGPTETAINVTHWQCQV
SDGLRSPIGRPLGNVLCRVLDSELNPLPRGVAGELCIGGIGLARGYLNRPGLTAERFVAD
PLGQPGERLYRTGDLVRWAADGALEYLGRLDQQVKLRGFRVEPQEIEARLLTQPGVGHAA
VLVRETAAGPQLIGYYTAEAGQDAQAERIKSALALELPDYMVPAQLVRLDSMPLSPIGKL
DRRALPEPQWQTREHVEPQTDLQKQIAAVWRQVLGVPRVGLRDDFFELGGHSLLATQIIS
RVRQACDIDLPLRALFEASELGAFVEQVQTIQLSGERSSLQPIARVDRSQPVPLSYSQQR
MWFLWQMEPDSPAYNVGGMARLNGVLDIERFEAALQALILRHETLRTTFPSVNGVACQKV
SEQTGLRVQWQDYSALPAELRQQRLQALADSEAHQPFDLETGPLLRACLVKAADLEHYFV
LTLHHIVTEGWAMDIFARELGLLYEAFLQGKPSPLEPLAVQYLDYSVWQRQWMEAGERQR
QLDYWTAQLGNEHPLLELPADRPRPAVQSHQGELYRFDLNPELAAKVRAFNARNGLTLFM
TMTATLAVLLYRYSGQNDLRIGAPVANRIRPESEGLIGAFLNTQVLRVQLDGQMSVAQLF
EQVRHTVIEGQSHQDLPFDHLVEALQPPRSAAYNPLFQVMCNVQRWEFQQSRELAGMTVD
YLVNDARATKFDLNLEVTELDHRLGCCLTYSTDLFDEPRIAQMAEHWLNLLQALLADPQQ
RLSELPLLQDAERQQLLDSLGVEAGEQRLDQCIHSLFAEQARLRADAPALTFAGETLSYA
ELDGRANQLAGMLRQRGVGPQVRVGLALPRSLDMVVGLLAILKAGGAYVPLDPEYPLERL
HYMIEDSGVGLLLSDRALFAALGELPAGVARWCLEDDQPLLASFSTDELPFISLPQHQAY
LIYTSGSTGKPKGVVVSHGEIAMHCQAVIRRFDMQPDDCELHFYSINFDAATERLLVPLL
SGARVVLRAQGQWDAEEICTLIRQQQVNILGFTPSYGSQLAQWLATQGQTLPVRMCITGG
EALTGEHLQRIRAVFQPELLFNAYGPTETVVMPLASLAPQQLEEGEASVPIGRVVGARVA
YILDADLALVPQGASGELYIGGAGLAQGYHQRPGMSAERFVADPFASNGGRLYRTGDLVR
QRADGLVEYLGRIDHQVKIRGFRIELGEIETRLLEHEAIREAVVLALDTPSGKQLAGYLV
SDVAGQGDEQQAQLRESLKSHLKAQLPDYMVPTHLILLDSMPLTANGKLDRRALPAPDPE
LNRQHYVAPASELEQQLAAIWCAVLNVEKVGLNDNFFELGGDSILSIQVVSRARQVGIHF
SPRDLFQHQTVQTLAAVATASELIQAEQGLLQGASALTPIQHWFFDTPIPERQHWNQSLV
LEPLTALDPRLLEQALRALLEQHDALRLSFTGQNGKWQAEHRAVTAETLLIQAQVADMAE
CAALYADTQRSLDLQNGPLLRALLVDGPQGQQRLLMVIHHLVVDGVSWRVLLDDLQTAYR
QLSEATPVRFAAKTSAFRDWAARLQAYAGNESLREELHVWQRQLGGPLAQLPCHNPQGGQ
QNRHAQTVSVRLDAERTRQLLQQAPSAYRTQVNDLLLTALAQVVCRWSGQPSTLVQLEGH
GRETLFDDIDLTRTVGWFTSAYPLRLTPAVAGDAAPGESIKAIKEQLRQVPHKGLGYGVL
RYLADSASKAAMQALPVAPITFNYLGQFDQSFASDALFRPLEESAGAAHDPHAPLPNELS
IDSQVYGGELLLRWTFSAERYQPAAIEALAQDYLARLQALIAHCLSDGSGGLTPSDFPLA
DLDQAQLDALPVAATHIEDVYPLTPMQEGMLLHTLLEPGTGLYYMQDRYRINSALDPERF
AQAWQAVIARHEALRASFCWDIGETMLQVIHKPGSTPIDYLDWRDVPEDQQEPRLQALLK
SEREAGFNLLDQPPFHLRLIRVDEARYWFMMSNHHILIDAWCRSLLMNDFFDIYTALGEG
REAQLTPAPRYRDYIGWLQRRGLAQARDWWQDNLRGFERPTPIPSDRPFLREHAGDSGGM
VVGDCYTRLDEGDGAQLRELAQQHQLTVNTFAQAAWALTLRRLSGDRDVVFGVTVAGRPV
ELPQMQRTVGLFINTIALRVGMPGDDQRCSVRQWLSQLLDSNMQLREYEYLPLVTIQENS
ELPKGQPLFDSLFVFENAPLEVSVLDRAQSLNATSDSGRTHTNYPLTAVCYPGDDLGLHL
SYDQRYFDESTVQNMLGEFKRLLLALIEGFHGDMSELALVSEQERTFLIEDCNQSEHAYP
LDKSYVELFEAQVEAHPQRIAVSCLDRQLSYAELNIASNRLGHALIEAGVSFDQPVALLA
ERGVELPGMIIGSFKAGGGYLPLDPALPDSRLSGIIGQSGTPLLVCSAQCLEQGRALLEA
LTESARPQLLVWETVQQRESAQHNPGRYSAPDNLAYVIFTSGSTGLPKGVMVEQRGMLNN
QLSKVPYLSLSERDVIAQTASQSFDISVWQFLAAPLFGARVDIVPNDIARDPQALLAHVQ
AQRISVLESVPSLITGLLAEQQATLDSLRWMLPTGEAMPPELASQWLQRYPQIGLVNAYG
PAECSDDVAFFRVDAASTRSAYLPIGSPTDNNRLYLLDEALDLVPLGAVGELCVAGAGVG
RGYVADPSRSVPVFVPHPFGAPGERLYRTGDLARRRKDGVLEYVGRVDHQVKIRGYRIEL
GEIETRLLEHSAIRETVVLAVDGPLGKVLAAYLVPSAATQDPDALRDELKNHLKASLPDY
MVPAHLVILEAMPLTPNGKLDRKALPAPDVSQAQQEYLAPQTEMEQQLATIWADVLKVER
VGITDNFFELGGHSLLATQVVTRAQKLLQRNVPLRAMFEFNTVQALAEHLQSLGGAQVDE
QKFDRLADLMAELEGL
NT seq 13011 nt NT seq  +upstreamnt  +downstreamnt
atggatgcgtttgaactccccgacactctggcccaggctcttcagcgtcgcgccttgcac
acgccggatcggctggcgctgcgtttcctcaccgacgagaaagaccagggactggtgttg
acctaccgtgacctggacctgcgcgcgcggaccatcgctgctgcgctgcaacgtcaagcc
gtgccgggtgatcgggcaactctgctgtttcacagtgggccggactatgtcgctgcgttt
ttcggctgcctgtacgccggggtcattgcggtgccggcttacccgccggaatccaatcgt
cgtcatcatcaggaacggctgctgtcgatcatcgccgatgccgagccacggctggtactg
accggttccgacctgcagcccgccttgctgcagatggatgagctggctgctgccgatgcc
ccgcaactgctctgcgtcgatacgctggacagtgcgtctgccgacaattggcaggggcca
caattgcaggccgacgacatcgctttcctgcaatacacctcgggctcaaccgccttgccc
aagggcgtgcaggtcagccatggcaacctggttgccaacgaactgttgattcgtcatggc
ttcggcatcgacgtcaatccggacgacgtgatcgtcagctggctgccgctgtaccacgac
atgggcctgatcggcggcttgttgcagccgattttcagtggcgttccgtgcatcctgatg
gcccccgcttacttcctcacgcggccattgcgctggctggaagctatcagcgaatacggc
ggcaccatcagcggcgggcccgactttgcctaccagctgtgcagcgcgcgggtcagtgat
tcggcgctggagcggctcgacctgagtcgctggcgcgtggcgtattccggctccgagcct
atccgcgaagacagcctgaatgcgtttgccgagaagttcgccagttgcggcttcacgcct
gacagcttcatggcctcctatgggctggccgaagccacgctatatgtagcgggtggcaaa
cgcggcaaaggcattccttcgctgcgtttgaatgcgcaggcgctggcgcgcaatgtggca
gagttgggcgacggtcagccagtcatgagctgcggcaccggccagccggggcatggcgta
ttgattgccgaccccgccaccctgcaagtgctggacgaaaaccgtatcggcgaagtatgg
gccagtgggccgagcatcgcccacggttactggcgcaaccctgaagccaccgccaaggcg
ttcgtccagcatgacggccagacttggctgcgtaccggcgacctgggctttcagcggcat
ggcgagttgtacatcaccggtcgtttgaaagacatgctgatcgtccgtggccacaacctg
tacccgcaggacatcgagaaagtcgtcgagcgcgaggtcgatgtggtgcgcaaaggccgt
attgcggcatttgcggtcaatcaggacggtagcgaaggcattgggatcgctgccgaagtg
agccgcagcgtgcagaaaatactgtccgccgaggcgctgatcaagatcattcgccaagcc
gttgccgaggcgtttcaagaagcgccgagcgttgtggtgttgctcaatccgggcgctctg
cccaaaacttccagtggcaagttgcaacgttcggcctgccgcacgcgtctggccgatggc
agcctggacagttacgcggtgtttcccgcgaacaatacaacgcatcaaaaccggaccctg
agcacaggatcggacctgcaagctcagatcgccagcgtctggtgcgagcatttgcaatgt
gagcagatcagcgccgacgatcatttcttcctgctgggcggcaactccatcgtcgccact
caggtagtggcccgtttgcgtgaaacgctgggcatcgacctgaacctgcgcctgctgttt
gaggcgccgacgctggccgcctttgcggcgcagatcgaagcgcttcaaatcgccgcatcg
caaggcgacagccagacgcagaacgctatcgtccgcctgcccggcaacgagcatctgcca
caatcgctggcacagaaccgcctgtggttcctttggcaacttgacccgcaaagcagcgcc
tacaacattcccggtggtctgtacctgcgtggcgaactggacaccacggcgttgcgtacc
agcttccagcgcctgatcgagcgccatgaatcgctgcgtacgcgcttctacgagcatgac
ggtgtcgccctgcagcgcatcgacgcgcccggtgagttccatttcgacactctggatata
agcgacctgccgagcgacgaacgccagacgcgtgcgctggcgatccgcgaagagcaggcg
cgtctgccattcgatctgcaaaacggcccgttgctgcgcgttacgctgctgcgactggac
gaggaagagcatcagttgctggtcacgctgcaccacatcattgccgatggctggtcgctg
aatgtgctgatcgacgaattctcgcggctctatgcgtcggctgttcaggggcagccactg
gaactggcacctctgccactgcgttacgccgactatggccaatggcagcgcgaatggctg
gcaaacggcgaggccgagcgccagctcgactactggaagcagcaactgggcgatgagcag
ccaaccctggaattgagcactgatcgtccgcgctcggcacatcagcagcacagcgcttcg
cgttacagcctgcgcctgagtgccgagctgagcgccgccgtacgcaacaccgcgcaagcc
tggcaatcaacgtcgttcatgctcttgctggcgggcttccaggccttgttgcatcgctac
agcgggcagaccgacattcgcatcggcgtgcccggtgccaaccgtcctcgtcatgaaacc
cagggcctgatcggcttcttcatcaacaccctggtgctgcgtgcgcaactcgatccgcgc
ctgccgttttccacactgctggcccagacccgccaggccgcgctggacgctcaggcgcat
caggacgtgccgttcgaacaactggtcgaagcgtttccgcaggcccgcgaacacgggctg
tttcaagtcatgttcaaccaccagcaacgcgacctcggcgcattgcgtcgcctgccgggg
ctgctcgccgaagaactgccgtggcacagccgcgaggccaagttcgacctgcaacttcac
agcgaggaagaccgtaacggtcgcctcaacctgtccttcgattacgccgacgagctgttc
gagcgcgacaccatcgtgcgtctggcgcggcactacgttcagttgctgacccaggtcagt
cagcaggcgcaggttgcgctgggcgacgtgcaattacttggcgctgacgagctgtccgaa
caggcgcagtggagcgctgccgcctgcacgcctgcacacgtctggctgcctgaaatgctg
gagcgtcaggcgctgcaaaccccggaacgcatcgcgttggtgtgggagggcggcagcctc
gatttcgccagcctgcatgcccaggccaaccgtctggcgcattacctgcgcgacaagggc
gtcggcccggacgtcaaggtggcaatcgccgccgagcgctcgccgcaactgttgatcggt
ctgttggcaatcctcaaggccgggggcgcctacgtgccgctggacccggattacccgatt
gaacgactggcctacatgctgcaagacagcggtgttgagctgctgttgacccagagccat
ctgctcggcgacctgccgagcgcagacggggtctgcacggttgcgatggacatgctgcac
ctggacagctggccggtcagcgcgccgggcctgcatttgagcggcgacaatctcgcgtac
gtgatttacacctccggctccaccggtcagcccaaaggcgtcggcaacacccacgcggca
ctggtcgagcgcctgcaatggatgcaggacacttatgggctggatgaaagcgacgtgctg
atgcagaaggcaccgatcagctttgacgtgtcggtctgggaatgcttctggccgctgatt
accggttgccgcctgctactggcaggccccggcgaacaccgcgacccgcatcgcatcgcg
caactggtcaacgagcacggtgtgaccacgctgcactttgtgccgcccctgttgcagctg
tttgtcgacgagccgctggcgcagcaatgcaccagcctgcgtcgcctgttctctggcggc
gaagcgttgccgagcgaactgcgcaaccgggtgctggagcatctgccgggcgtacaactg
cacaaccgttatggcccgaccgaaactgcaatcaacgtcacccattggcaatgtcaggtt
agcgacggcctgcgttcaccgattggtcgtccgctgggtaacgtgctgtgccgggtgctg
gacagcgagctcaacccgctgccgcgtggggttgccggggaactgtgcatcggtggcatc
ggcttggcgcgtggctacctgaatcgtccgggcctgaccgccgaacgctttgtcgccgat
ccgctgggccagccgggtgagcgcttgtaccgcaccggcgacctggtgcgctgggccgct
gacggtgcgctggaatatcttgggcgtctggatcagcaggtcaaactgcgtggcttccgc
gtcgaaccgcaggagatcgaagcccgtctgctgacccagccgggtgttggtcatgctgcc
gtgctggtgcgcgaaaccgctgcgggcccgcaactgatcggttactacaccgccgaagcc
gggcaggacgctcaggccgagcgcatcaaatcggcgctggctctggaactgccggattac
atggtcccggcgcagctggtgcgcctcgacagcatgccgctgagcccgattggcaagctg
gatcgacgcgccttgcccgagccgcaatggcagactcgcgagcatgtcgagccgcaaacc
gacctgcaaaagcagatcgccgctgtctggcgccaagtgctgggcgtgccgcgcgtcggc
ctgcgcgacgactttttcgagctgggtgggcactcgttgctggccacgcagatcatttcc
cgcgtgcgtcaggcctgcgatatcgatttgccgttgcgtgcgctgttcgaagccagcgag
ctgggcgcgtttgtcgaacaggttcaaaccattcagctgtcgggcgaacgcagcagcctg
caaccgatcgcccgtgtcgaccgcagtcaaccggtgccgctgtcttattcccaacagcgt
atgtggttcctctggcagatggaaccggacagcccagcgtacaacgtcggcggcatggca
cgcctgaacggcgtgctcgatatcgaacgtttcgaagccgcgctgcaagccttgatcctg
cgccacgaaaccctgcgcaccaccttcccgagcgtcaacggcgtagcgtgccagaaggtc
agtgaacagaccggcctgcgcgtgcaatggcaggattactcagcgctgcctgccgagctt
cgtcagcagcgccttcaggcactggccgacagcgaggcgcatcagccttttgatctggag
accggtccgctgctgcgtgcctgtctggtcaaggcggctgatcttgagcattacttcgtt
ctgaccctgcaccatatcgtcaccgaaggctgggcgatggacattttcgctcgcgaactg
ggcctgctctacgaagcatttctgcaaggcaagccgtcgccgctggaaccgctggcggtg
caatatctggattacagtgtctggcagcgtcagtggatggaggcgggcgagcgccagcgc
cagctggattactggaccgcgcagttgggtaacgagcatccgctgctggaactgcccgct
gaccggccacgcccagcggtacaaagtcatcagggcgaactgtaccgtttcgacctgaat
cccgaactggccgccaaagtccgcgcgttcaacgcccgcaatggcttgaccctgttcatg
accatgaccgccacactggcagtgctgctctaccgttacagcggccagaatgacctgcgc
atcggtgcgccggtggccaaccgcatccgtccggaaagcgaagggctgattggcgcgttt
ctcaacacccaggtgctgcgcgtgcagcttgacgggcaaatgagcgttgcgcagctgttc
gaacaggttcgtcacaccgtcattgaaggccagtcgcatcaggacctgccgttcgatcat
ctggtcgaagccctgcaaccgccacgcagcgcggcctacaacccgctgttccaggtgatg
tgcaacgtgcagcgctgggaattccagcaaagtcgcgagctggcgggcatgaccgttgac
tatctggtcaacgatgcgcgtgccaccaaattcgacctcaacctggaggtcaccgagctg
gatcaccgcctgggttgctgcctgacctacagcaccgatctgttcgacgagccgcgcatc
gcgcaaatggccgagcactggctgaacctgctacaagcactgctcgccgacccgcaacag
cgcctgagtgaactgccgctgttgcaggacgccgaacgtcagcaactgctcgacagcctc
ggcgtcgaagccggcgaacaacggcttgatcagtgcattcacagcctgttcgccgaacag
gcccggctgcgcgcagatgcgcctgcgttgacctttgccggggaaaccctgagctacgcc
gagctggacggccgcgccaaccaactggccggaatgctgcgccagcgcggcgtcggcccg
caggttcgcgtcggcctggcgctgccacgttcgctggatatggttgtcggcctgctggcg
atcctcaaggccggtggtgcctacgtgccactggacccggaatatccgttggaacgcctg
cactacatgatcgaagacagcggcgtcggcctgctgttgagcgaccgtgcgctgtttgcc
gcgctgggcgagctgcctgccggtgtggcccgctggtgcctggaagacgatcagccgctg
ctggcgtctttctcaaccgatgaactgccgtttatcagcctgccgcagcatcaggcttac
ctgatttacacctccggttcgaccggcaagcccaaaggcgtggtggtgtcccacggtgaa
atcgccatgcattgtcaggcggtgattcgtcgcttcgacatgcagcccgatgactgcgaa
ctgcatttctattcgatcaacttcgatgccgccactgagcgtctgctggtgccgctgctc
agtggtgcgcgcgtggtattgcgcgcccaagggcagtgggatgccgaagaaatctgcacg
ctgattcgccagcagcaggtcaatattctcggcttcacccccagctatggcagccagttg
gcgcagtggctggccactcaaggccagaccttgccggtgcgcatgtgcatcaccggcggt
gaagcgctgaccggtgaacacttgcagcgtattcgcgcagtcttccagccggaactgttg
ttcaacgcctatggcccgaccgaaaccgtggtcatgccgttggccagcctggccccgcag
caattggaagagggcgaagccagcgtaccgatcggtcgtgtggtcggggcgcgggttgcc
tatattctcgacgccgatctggccctggtgccacagggcgcgagcggcgaactgtatatc
ggcggtgccggtctggcgcagggctaccatcagcgccccggcatgagcgccgagcgcttt
gtggccgacccgtttgccagcaacggcgggcgtctgtatcgaaccggcgacctggtgcgc
cagcgcgccgatgggctggtggaatatctggggcgtatcgaccatcaggtgaagattcgt
ggcttccgtatcgaactgggggaaatcgaaacccgtttgctggaacacgaagccatccgc
gaagccgtggtgctggcgctggacacgccgtcgggcaagcaactggcgggttatctggtc
agtgatgtggccgggcagggcgacgagcagcaggcgcaattgcgtgaatcgctcaagtcg
cacctcaaggcgcaactgccggattacatggtgccaactcacctgatcctgctcgacagc
atgccgctgaccgccaacggcaagctcgaccgacgcgcattgcctgcaccggacccggaa
ctcaatcgtcagcattacgtagcccctgccagtgaactggagcaacagctggcagcgatc
tggtgtgcggtgctgaatgtggagaaagtcggcctcaacgacaacttcttcgaactgggc
ggcgattcgatcctgtcgattcaggtggtcagccgggcgcgtcaggtgggtattcatttc
agcccgcgtgatctgttccagcaccagaccgtgcagaccctggccgccgtggcgaccgcc
agcgaactgattcaggccgaacagggcctgctgcaaggcgcatccgcgctgacgccgatc
cagcactggttcttcgacacgccgattcccgagcgtcagcactggaaccagtcgctggtg
ctggagccgctcactgcactcgacccgcgtctgctggagcaggcactgcgggcgctgctc
gaacagcatgacgccctgcgcctgagcttcaccgggcaaaacggcaaatggcaggctgaa
caccgtgcagtgacggcagaaaccctgttgatacaggcgcaggtcgccgacatggccgaa
tgtgccgcgctgtacgccgacacccagcgcagcctcgacctgcaaaacggcccgctgttg
cgcgccttgctggtcgatggtccgcagggtcagcaacgtctgctgatggtcattcaccat
ctggtggtcgatggcgtttcgtggcgggtgctgctcgacgatttgcaaacggcctatcga
cagttgagcgaagcaacgccagtgcgctttgccgccaagaccagtgcgttccgtgactgg
gccgcacgtttgcaggcctacgcgggtaacgaatcgttacgtgaagagctgcacgtatgg
cagcgtcagcttggcggtcctttggcgcagttgccgtgccacaacccgcagggtggccag
cagaatcgtcatgcgcaaaccgtcagcgtgcggctggatgccgaacgtacccgacaactg
ctgcaacaggcacccagcgcataccgcactcaggtcaacgacctgctgctgacggcgctg
gcgcaagtggtctgccgctggagcgggcaaccatcgacgctggtccagctggaagggcac
ggccgcgaaaccctgtttgacgacatcgacctgacccgcacggtcggctggttcaccagc
gcttatccgctgcgcctcacgccagcagtggctggcgatgcagcgccgggggagtcgatc
aaggcgatcaaggagcagctgcgccaggtgccgcacaaaggcctgggctatggcgtgctg
cgctatctggccgacagtgccagcaaagccgccatgcaggcgctgccggtggcaccgatc
accttcaactacctcggtcagttcgaccagagcttcgccagcgatgcgttgttccgtccg
ctggaagagtcagcgggcgcggcccacgatccgcatgcgccgctgcccaacgagctgagc
atcgacagccaggtgtatggcggcgaattgctgctgcgctggactttcagtgccgagcgt
tatcaacccgccgccatcgaagcgctggcgcaggattacctggcccggttgcaggcgctg
attgcccattgcctgagcgatggcagcggtggcctgacgccttcggacttcccgctggcc
gatctggatcaggcgcaactcgacgcactgccggtcgctgcgacgcacatcgaggacgtc
tacccgctgacaccaatgcaggagggcatgctgctgcacaccctgctggaaccgggcacc
ggcctgtattacatgcaggaccgctatcgcatcaacagcgcgctcgatccagagcgtttt
gcccaggcctggcaggcggtgatcgcccgtcatgaagcgctgcgcgcctcgttctgctgg
gacatcggcgaaaccatgctgcaggtcatccacaagccgggtagcacgccgattgattat
ctggactggcgtgacgtaccggaggaccagcaggagccgcgtttgcaggccttgctcaag
tccgagcgcgaggccggtttcaacctgctcgatcagccgccgttccacctgcgtctgatt
cgcgtcgatgaagcgcgctactggttcatgatgagcaaccaccacatcctcatcgatgcc
tggtgccgttcgctgctgatgaacgacttcttcgatatctacactgcgctgggcgaaggt
cgtgaagcacaactgacgcctgcaccgcgttatcgcgactacattggctggctgcaacgc
cgtggcctggcgcaggcgcgtgactggtggcaagacaacctgcgcggcttcgaacggccg
acgccgatccccagcgaccggccgttcctgcgtgaacatgcgggcgacagcggcggcatg
gtcgtgggcgattgctatacccgtctcgatgaaggcgacggcgcacaactgcgcgagctg
gcgcagcagcatcaactgaccgttaacaccttcgcccaggcagcgtgggccttgaccctg
cggcgcctgagcggtgatcgcgacgtggtgttcggcgtcacggtggccggtcgtccggtg
gagctgccacaaatgcagcgcaccgttgggctgtttatcaacaccatcgcgctgcgcgtc
ggcatgcccggcgacgatcagcgttgcagcgtgcgccagtggctgagccagttgctggac
agcaacatgcaactgcgcgagtacgaatacctgccgctggtgaccattcaggagaacagc
gaactgcccaaaggccagccgctgttcgacagcctgttcgtgttcgagaatgcgccgttg
gaagtttcggtgctcgaccgtgcacaaagcctcaacgccacgtcggattccggccgcacc
cacaccaactatccgctgacggccgtctgctatccgggcgatgatctgggcctgcacctg
tcttacgaccagcgttatttcgatgagtccaccgtgcagaacatgctcggcgagttcaag
cgtctgctgctggcgctgatcgagggcttccacggcgacatgagcgaactggcactggtc
agcgagcaggagcgcacgttcctgatcgaggactgcaaccagagcgagcacgcgtacccg
ctggataaaagctacgtcgaactgttcgaagcgcaggtcgaagcacatccgcagcgcatt
gcggtcagttgcctggatcgccagctcagttatgccgagctgaatattgccagcaaccgt
ctgggccatgccctgatcgaggccggtgtcagtttcgatcagccggttgccttgctcgcc
gagcgtggcgttgaactgccgggcatgatcatcggcagcttcaaggccggtggcggttac
ctgccgctggacccggcgctgcccgattcgcgactgagcggcatcatcggccagagcggc
acgccgctgctggtgtgcagcgcgcaatgtctggaacagggcagggcgctacttgaagcg
ctgaccgagtccgctcgtccgcagttgctggtttgggaaactgtgcagcagcgcgaatca
gcgcagcacaaccccggccgctacagcgcaccggacaacctcgcttacgtgatcttcacc
tccggctccaccgggctgccgaagggcgtgatggtcgagcagcgcggcatgctcaacaac
cagttgagcaaggtgccgtacctgagcctgagcgaaagagatgtcatcgcccagaccgct
tcgcagagtttcgacatctcggtctggcagttcctcgctgcgccgctgtttggcgcgcgg
gtggacattgtgccgaacgacatcgcccgcgacccgcaggccttgttggcgcatgtgcag
gcccagcgcatcagcgtgctggaaagcgtgccgtcgctgataaccggcctgctcgccgag
caacaggcaacgctcgacagcctgcgctggatgctgccgaccggcgaagccatgccgccc
gagctggccagccagtggctgcaacgctacccgcagatcgggctggtgaatgcctatggc
ccggctgagtgttccgacgacgtggcgttcttccgcgttgatgcagcgtccacacgcagc
gcttatctgccgatcggttcgccgaccgacaacaaccgcctgtacctgctcgacgaggcg
ctggacctcgtgccgctgggcgcagtgggtgagctgtgcgtggccggggccggggtcggt
cgtggttatgtcgctgatccctcgcgcagcgtgccggtgttcgtgccgcatccgttcggt
gcaccgggcgagcgtctataccgcacaggtgacctggcgcggcggcgcaaggacggcgtg
ctggaatacgtcggccgggtcgaccatcaggtgaagattcgcggttatcgcatcgagctg
ggcgaaatcgaaacccgcttgctggagcattcggcgatccgcgagacggtggtactggcc
gtcgacggtccgctgggcaaagtgctggcggcctatctggtgccaagcgctgccacgcag
gatcccgatgcgctgcgagacgagctgaaaaaccacctcaaagccagcctgccggactac
atggtgcctgcgcatctggtgattctggaggccatgccactgacgccgaacggcaagctt
gaccgcaaggccttgcctgcgccggacgtcagtcaggcgcagcaggaatacctcgcgccg
cagaccgagatggagcagcaactggcgaccatctgggccgatgtgctcaaggtcgagcgg
gtgggcattaccgacaacttcttcgagttgggagggcactcgctgctcgctacccaggtc
gtcacccgtgcgcagaagctgttgcagcgcaacgtgccattgcgggcgatgttcgaattc
aacaccgttcaggcgttggccgagcatctgcaaagccttggcggagcgcaggttgacgag
cagaaattcgaccgtctggcggacttgatggcggaactggaagggctctga

DBGET integrated database retrieval system