KEGG   Psychrobacter sp. P2G3: AK823_11165Help
Entry
AK823_11165       CDS       T04386                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pspg  Psychrobacter sp. P2G3
Pathway
pspg00473  D-Alanine metabolism
pspg00550  Peptidoglycan biosynthesis
pspg01100  Metabolic pathways
pspg01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pspg00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    AK823_11165
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AK823_11165
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    AK823_11165
Enzymes [BR:pspg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AK823_11165
Peptidoglycan biosynthesis and degradation proteins [BR:pspg01011]
 Precursor biosynthesis
  Amino acid ligase
   AK823_11165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp TTL DUF937 ATP-grasp_3 ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: AMN51008
LinkDB All DBs
Position
complement(2739720..2740634)
Genome map
AA seq 304 aa AA seqDB search
MKDASEFGKVAVVYGGSSNERSVSLDSGAAVLQALQNQGVDATHFDPKHQDITELRDYDR
VFNVLHGRGGEDGLLQGVLQWFDIPQTGSGILASALGMDKVRTKQLWQGCGLSTAPFSLL
TADTDWQQVVNMLGLPLIIKPVHEGSSIGMTKVNHLDELPAAYATAVQCGDVVMAERWIT
GREFTIVIIDDEAYPVIRLEPADITNFYDFEAKYNRNDTGYYIPCGLSNSDEKHLQDLSL
AAFRAVNAKGWGRVDAMQDEAGNFWLLEINTVPGMTSHSLVPMAAKAQGMDFDTLCWHIL
AQTL
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagatgcgagtgagtttggtaaggtggctgtcgtttatggtggcagtagcaatgag
cgcagcgtgtcattggacagtggggccgccgtattgcaagcgctacaaaatcaaggcgtc
gatgccactcattttgatcctaagcatcaagacattactgagcttcgtgactatgatcgc
gtgtttaacgtgttacatggtcgcggcggcgaagatggtttgctacaaggcgtgttgcaa
tggtttgatattccgcaaacaggttcagggattttagcatcagccttaggaatggataaa
gttcgtactaagcagttgtggcagggttgcgggttatcaacggcaccattttcattgttg
acagctgataccgactggcagcaagtggtgaatatgttgggtttacctttaattattaaa
cctgtacatgaaggttcaagtattggcatgactaaggtcaaccatcttgacgagttgcct
gctgcctatgcaacggcagtacagtgtggcgatgtagtaatggctgaacgctggattacg
ggtcgtgagtttacaattgttattattgatgatgaagcctatccagttattcgtttagaa
cctgctgatatcactaacttttacgattttgaagctaaatataatcgcaatgatactggc
tattatattccttgtggactcagtaatagtgatgaaaaacatttgcaagacttgagcctt
gctgcgttccgtgccgttaatgcaaaaggctgggggcgtgtcgatgctatgcaagatgag
gctggcaatttttggttactagaaatcaatacggtacctggtatgaccagtcatagctta
gtcccgatggcagctaaagcacaaggtatggactttgataccttatgctggcacatactg
gcacaaacactttaa

DBGET integrated database retrieval system