KEGG   Pandoraea sputorum: NA29_11855Help
Entry
NA29_11855        CDS       T03554                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K22187  
alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
pspu  Pandoraea sputorum
Pathway
Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:pspu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    NA29_11855
Enzymes [BR:pspu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     NA29_11855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2671831..2673285
Genome map
AA seq 484 aa AA seqDB search
MTTVPTFFNYIDGEWCASQTGRTFENRNPADTRDVVGEFQASGEADATAAVQAAASAFSA
WKRAAPGARAKVLLSAAAYLERHAERFGDELAREEGKQKSLAKDEFLRASQTLRYYAIEA
QSFGGETFPNDDADMAVYTVREPLGVVTVISPWNFPVSIPARKIAPALICGNTVVFKPAT
DAPLSGLRLVEAFVEAGIPRGVLNFVTGSASAVGPVLVGAKEIRAISFTGSTSAGEQIHR
AASMSTRTQMELGGKNALIVLASRDIDRAVDLTVKGGFSLTGQACTGTSRVLVAREIRAA
FVEKLVARTAALKIGPGLEAGNDIGPLATEGQLRTVLEYVEIGRGEAKLVCGGTQIVDGA
YAHGYFVTPAIFTDVPRDARIAREEIFGPVIAVIDVDGYEDAIAVANDSDYGLAASLVTQ
DACLMHRFVDDIEVGTVKINRTTTGNLINAPFGGLKRSSTATFRESGRDGLDFYLQVKTI
YRGV
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgacaactgtgcccacgttcttcaactacatcgacggtgaatggtgcgcgagccagacc
ggacgcaccttcgagaaccgtaaccccgccgacacacgcgatgtcgtcggcgaatttcag
gcatccggcgaagccgacgcgacagcggcggttcaggcagccgcctcggcattctccgca
tggaagcgtgccgcgcccggcgcgcgcgccaaagtcttgctgagcgcggcggcttatctg
gagcgtcatgcagagcgattcggcgacgagcttgcccgcgaggagggcaagcagaaatcg
ctcgctaaggacgagtttctgcgagcgtcccagaccttgcgttactacgccattgaagcc
cagtcgttcggcggcgagaccttcccgaacgacgatgcagacatggcggtgtataccgtt
cgcgaaccgctcggcgtcgtgaccgtcatttctccgtggaatttccccgtctcgattccg
gcgcgcaagattgcgcccgccttgatctgcggaaacacggtcgtattcaagcctgccacc
gatgcgcccttgagtggcctgcggctggtcgaggcgttcgtcgaagcgggtatcccgcgc
ggcgtgctgaatttcgtcacgggcagcgccagcgctgtcgggccggtgctggtcggcgca
aaggagatccgggcgatttccttcacggggtcgacatctgcgggtgagcagattcaccgc
gctgcatcgatgtcgacgcgcacgcaaatggaactcggcggcaagaatgcgctgatcgtg
ctggcatcccgcgacattgaccgtgccgtcgatctcacggtgaagggcggattctcgctg
acggggcaggcatgcacggggacgagccgcgtgctggtcgcccgtgagattcgtgcggcg
ttcgtcgaaaagctggtggcgcgaacagcggcgctcaagatcggtccgggccttgaggcg
ggcaacgatatcgggccgctcgccaccgaggggcagcttcgaacggtacttgagtacgtc
gagatcggtcgtggcgaagccaaactggtttgcggcggaacacagatcgtggacggtgcc
tatgcgcacggctacttcgtgacacccgcgatcttcactgatgtgccccgcgatgcgcgc
atcgctcgtgaagaaatcttcgggccggtgatagccgtcatcgatgtcgatggctacgag
gatgccattgcggtggccaacgacagcgactacggactggccgcttcgctggtcacgcag
gacgcgtgcctcatgcatcgcttcgtcgacgacatagaagtcggcaccgtcaagatcaat
cgcacgacgaccggcaatctgatcaacgccccgttcggtggcctcaagcgctctagcacg
gcgacgttccgcgaatcggggcgcgacggcctcgacttctatttgcaggtcaagacgatt
tatcgcggcgtctga

DBGET integrated database retrieval system