KEGG   Pandoraea sputorum: NA29_12790Help
Entry
NA29_12790        CDS       T03554                                 

Definition
(GenBank) hypothetical protein
Organism
pspu  Pandoraea sputorum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2889904..2903181
Genome map
AA seq 4425 aa AA seqDB search
MNDALRLPVPFGPVSSTAPSQGAPGAPIEHIVDLLRARARLEPDREALCAVSSDEGDARA
LTCAALDTRARAVAAALQRLAKGKEGAYGERGLLLMPTGLDYVAGFFGCLYAGAIAVPAF
PPESARPQHLARVRSILHDARARFVLTDRQHRDAMLAFGDAVPELRGVEIVVIDEIDDAL
ATEWQETTVAPGDLAFLQYTSGSTSTPKGVMVSHANLMANEAAIVAGLGMTRDDTMVSWL
PLYHDMGLIGGLLSPIYRGARLVLMSPQFFLERPVRWLRAIDKFGGTVSGGPDFAYRLCA
QRIDAATIGSLNLRGWRLAFSGSEPVRHDTLVDFCEAFAPAGFDPKAVYPCYGLAEATLF
VTGGQRGDGMTATDFDRSALAQQRAEASGDHSDDSAMLVGCGTTPLDHEVRLMTWNDSPD
VTPSAVAAGGVGEIWVSGPSVAQGYWRNEEASARTFVQADGKRWLRTGDLGFVHDDQVYI
TGRCKDVIIVRGHNLYPQDLEKAVEADVELVRKGRVTAFAVDIDGEPGIGIAAEVGRSVQ
KMVPPQTLAEVIAVAVSDVCQQAASVVVLLNPGALPKTSSGKLQRSACAKGWRDGSLDAW
ATWQNGAILGDDDARASSSDKPDAPKQDATFEAVAQIWREVLGREQVRADDHFFLCGGSS
LLAMQVLARVRERLGVNATPASLYEHARLGEWVRELAKFTPSSSAQAIDAVPEILPATPL
AQTPDARVFRQSFAQSRLWFVHRLDPANSAAYHVGGQLLVKGRFDANAFSRALEVITARH
DALRTTFDERDGVAVQIVHAKADVPLVSHDVSGDANPDAAATRLTDALLAQPFALDTCAP
WRVASIRLSVEAHRIVFVLHHLLTDAWSMTLLVDELARAYSGFSDGKTPVLAPVPVQPGD
HAHWQHACVNGEALGRQLDWWQARLPEPSPVLALPVDRTRGALRSGAGQTLAFEFPAGLT
RDVLTFAAQRKATPFIVLAASFQWLLHRYAGETDIRVGVPIAQRDVSGLERMLGCLVNTQ
VWRAQIDPAADFDGLVTQVRDGALAAQAHREAPFERVVERVAPQRSLGQSPLFQVMLNHH
VANAAASRAATGWPAGLSVVAQPLTGGAQYDLALDIDELHEATAGKGADPLDGVTLRARL
TFPTDLFDTPTIERLGADWCAGLATLLALPTQPLASLDVAFESALEGGHRIAHAEDALPF
QSVPSLIDVQAQQQPSAIALRDEAGTLTYAELVRAANRIAHWLLAQGVAPEARIGLAMSR
QTGMIAGLLGIMKAGCAFVPLDPSYPAERLAQIIDDAGISLALTEASLADALWLPVRRAV
VADLMADATLPDHPPGGSLHPDQLAYLIYTSGSTGTPKGVAVAHGPLAMHCVATGAQYRL
TPEVCELHVLSINFDGAHERWMAPMICGASLFIADERHWAPQTMVDAMRRHGVTNAGFPT
AYLCRLATSGATGAPALRLLSFGGEAMALPALRAAQAMFRPAQTINGYGPTETVMTPVAW
SIDGVLDAQPAAQIAGQAYAPIGEPVGRRRAWVLDPWLGEVPLGAVGELYLGGEGVARGY
FARAALTAERFVPDPRGEPGARMYRTGDRVRRLADGTLVYLGRFDQQVKVRGFRIEPGEV
ETQLLREPGVDDALAVVAAGPAGDQLVAYVAGKGLGGEALRVALSRRLPDYLVPSLVIVL
DSLPKLPNGKRDRAALPAPVWGSAGGQAPQGEAEFALAVVWQDLLRVPSVSRDDNFFALG
GDSIVALQMVGRARQAGWQFGAQDVFRHQTLVRLAAQARAVGEGDGAARVPEPLEGEVPL
TPVQAWFFRQPIACRDHWNQWVEATLPVGTDMTALREALATVVKHHDALRLRFTEHDGQW
QARYVAPHAADDLLWHAAMCDDAQLADALAQAQRSLSLADGPLLRALLVRTEAGELRCFL
VAHHLVIDGVSWRILLDDLQTALGNTHGERAVRTLPVVGESMRAWAQRWHDWTQSDAASA
ALEVWQRALAGAVESVDVARPTNATVGAVGTGEIEHTWPADVAVPLTQLRRVRMHEALSA
AVAHTLGQRAGAQRYVVHVEGHGRGGQGGGQEQGDLSRTLGWFTAAWPLAILVGSTPEET
LAAAREAWRCVPHDGASYAALRYLGTPQARQTLDALPAGHVTVNFLGRTDTDGIVDGGLS
HEPDVAPPNWLTLDVWQRDDTLRLVCRYDRARFTSDGVQTLVDEIGATLRVLAETLPGHE
PVVAEDFPYAGLTREQLATLPASMQQIEAVVPATSMQQGLLFYSQQQGTADPYFYQKGFV
IDGALDTSAFAQAWREAVMRHAALRTAYVSDVGELPLLLVHGPETVATAINLLPQEDWCA
LSETEQHARLDARFAAERAAGFSFAQANRPRLALIRVGESRWWLLWSSHHVTLDGWSTGL
ILSDVMSRYASLAKGGVSTDGEVQVAPSFAEFAVWQRELDARASLAHWRHLLDGVGAPTP
LPAARQARQARRTDETSGHGETAWTLAPSQWQTWCDAARRVGVTPGTLCQGAWALLLARH
AGLRDVVFGVTASGRSAAVPGIERMAGLFINTLPVRATLDARRPVADWLRELQTQTAQSR
EHEHVALSAITREAQRDGQSADGALFESIVVFENYPLDAALLAQRDDGLRLSLLERGTQA
RNNYPLSLIVEQHDGLRLVLAFARERFDAAAVQALGEHFVALLGAVADSLGTSTTPLGQI
GLTNAVPQTAENVVWSSHDLLNDWHAHVARDGAALAAEGEDASYRRDELDALANRLAATL
QAQGIGPEDRVAICVPRSAALVGAILGAWKAGAAYVPLDPEQPAVRLQKLVRASGAKAVI
VDDRTPAITHPSLIRWRDIAHASVDTKAPSPVRVHPAQAAYVIYTSGSTGEPKGVVVSRG
ALHNYVQAVAARLRERGLDTAGETGGFAMASTVAADLGHTTLFGALALGRALYLVPHACA
FDAQRFADWCAARPIDVLKIVPGHLNGLFDAAGAAVLPRAVLVTGGESLDPSFVAQIRGA
RPGLAVLNHYGPTETTVGALTHAVGDIAEVPVPVGRPLANLHAHVLDADLNPLPSGVAGE
LYLGGAGLARGYLGAPAQTAERFVPDPWCAGARLYRTGDRAVQRTDGAIVYLGRMDDQVK
IRGYRVEPAEVAQAMRCVPGVIDAVVVARHDGPGGAWLHGVFTGEAGLDVVRTALTQALP
SAWIPARFDSVDKLPLTANGKVDRRALLALTERVDAAKESAEVASVELPHVGAEADIAAI
WCQVLKREQVGRHEAFFDIGGDSILALQVIARLRKRGIKVGPQHLASHPTVAQLATLAAP
AEATSAQTPSAVSGPTRGDDNRSTFPLSSSQMRVWLETQMAPRAGAYHIAGALRLDGALQ
ADALERALQTLSDWHDVLRTTVAVNATEGGAPEQRVHAALPVAFTRDAVAPGMSGDATSA
LVQARLEALTLAQFDLANGPLWRVHLMQLDDQSHVLMLVMHHLISDGWSMNLLVADLARA
YRSHAGGRQPVRDAWASLLRYGDYAVWQREQLAGPAQAAQLAYWCQQLGTTHPELALPFD
RARPVVRDGAGASVDLTMPPGLPARLDRFAREHGVTRFMVMAAAFHLLLHRVTGEGDVRT
GMPVAGRAHEAVEAVVGFFVNTQVLRSQIESPTTFATLVTQVRDQLLGAQQHADVPFERL
VEHLAPVRSVSRHPLFQVSINHQKRAFAPLSDLAGVTMQAIERRAHHAQVDLALDTEEDE
AGALRGWLTYACDVFDAPTVRRLGEQWLALLDVAMTQATTPVARLAMTTGDAAGQRNDKG
RTRVSVAVPLPVHAVIDAQAAVRRDAIAVCDANTRVSYSELVTRANRVAHALIRAGVAPE
ARVGLAMSRSTDLIVAMLGILKAGAAYVPLDPAYPAERLSFMVEDAGVTHAITQASLAGA
SWLPGEAITFESMLADASLPEHAPMRDVHVDQLAYVIYTSGSTGRPKGAQLTHRNLMRLL
TGTSQDFAFDANDVWTMFHSYAFDFSVWEIFGALAHGARLVVVSQDTTRDPAAMWKLVAS
EGVTVLNQTPSAFYQWLGAMPSDAMSTTLRHIVFGGEALTPARLAAWWQRFGEATRLTNM
YGITETTVHVSQHVLHRGDTAGSPIGEPIADLDWRVLDAGLNEVPPGVAGDLYVCGDGLA
RGYLGQAGLTAERFVPDPKGAPGERMYRSGDRARRLADGTLDYLGRGDAQVKLRGFRIEL
GEIESQLLRHEDVTDAAVLVRDDGAGEQLVAYVVLSPERIADVDTAALWSRLRAHLGGAL
PAYMVPGQWLRLDALPLTPNGKLDRRALPVPEAAGAAQFEAPRDGNEARIASIWQEVLGV
PRVGRHDDFFALGGHSLLATQVASRLRDALSLDVPLRTLFEASRLTALAQALDAMTGASP
ASPALADDDLQAALREMESLSPDALQALLGPDATHGAIHGQSKHG
NT seq 13278 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacgctctccgcttgcccgtccccttcggccctgtctcgtcgacggcgccctct
cagggagcgcccggcgctcctatcgaacacattgtcgatcttctgcgcgcgcgtgcccgg
cttgagccggatcgcgaggcgctatgcgccgtgtccagcgacgagggcgacgctcgggcg
ctgacctgtgccgcgctcgatacgcgcgcccgcgcggtggctgccgcgctgcaacgtctc
gccaaggggaaagagggggcctacggcgagcgcggattgctgcttatgccgacgggattg
gattacgtcgcgggcttcttcggctgcctatacgcgggggccattgccgtgccggcgttt
ccgccggagtcggcgcgtccgcagcatctggcgcgcgtgcgctcgatcctgcacgacgcg
cgtgcacgcttcgtgttgaccgaccgtcagcatcgcgacgccatgctcgcgtttggtgac
gccgtgcccgagctgcgcggtgtcgagatcgtggtgatcgatgagattgacgacgcgctc
gcgaccgagtggcaggagacgaccgtcgccccgggcgatctggcgttcctgcaatacacg
tcgggctcgacgtccacgcccaagggcgtgatggtcagccatgcgaatctgatggctaac
gaagccgccatcgttgccgggctgggcatgacgcgcgacgacaccatggtgagctggttg
ccgctgtatcacgacatggggctgatcggcggcttgctttcgccgatttatcgtggggcg
cgtctggtgctcatgtcgccgcagttctttctggagcggccggtgcgctggctgcgcgcc
atcgacaaattcggcggcaccgtcagcggcggccctgatttcgcgtatcgcttgtgcgcg
cagcgcatcgacgcggccaccatcggttcgctgaacctgcgtgggtggcggctggcattc
tccggctcggaaccggtgcgacacgacacgctggtcgatttctgtgaagcgttcgcgcct
gcgggcttcgatccgaaggcggtttatccctgctatggactggccgaggcgacacttttc
gtcaccggcggacagcgtggcgacggcatgacggcgaccgacttcgaccgcagcgcactc
gcgcagcaacgggcggaagcctcgggcgatcatagtgacgacagtgcaatgctggtcgga
tgcggcacaacgccgctcgatcacgaagtgcgtctgatgacgtggaacgattcgcctgac
gtcacgccgtcggcggttgcggcgggcggcgtgggcgagatctgggtgagcgggccgagc
gtagcgcagggctattggcgtaacgaggaggcgagtgcgcggacgttcgtgcaggcggac
ggcaagcgctggctgcgcacgggcgacctcggctttgtgcacgacgatcaggtgtacatc
acgggccgctgcaaggatgtcatcatcgtgcgcggccataacctgtatccgcaggatctg
gaaaaggcggtcgaggcggatgtcgaactcgtgcgcaagggccgcgtgacggcgtttgcc
gtcgacatcgatggcgaacctggcatcggcatcgcagcggaagttggtcgcagcgtgcag
aagatggtgccgccgcagacgctcgccgaagtgatcgccgtagcggtctccgacgtttgc
cagcaagccgcgtcggtggtcgtgctgctcaatccgggcgcgttgcccaaaacgtcgagt
ggcaagttgcagcgcagtgcctgtgcgaagggctggcgagacggctcgctcgatgcgtgg
gcgacctggcagaacggtgcgattctcggggacgacgatgccagagcgtcgtcgagcgac
aagcctgatgcgccgaagcaggacgccacgtttgaggccgtcgcgcaaatctggcgtgag
gtgctggggcgcgagcaggtccgtgccgacgatcatttcttcctgtgcggcggcagttcg
ttgctcgccatgcaggtgctggcgcgcgtgcgtgagcgtctcggcgtgaacgcgacgcca
gcatcgctgtacgaacacgcgcggctaggcgagtgggtgcgcgaactggcgaaattcacg
ccttcctcgagcgcacaagccattgacgccgtgcccgagatcctgcccgcgacaccgctc
gcgcaaacgccggacgcccgcgttttccgtcaatcgtttgcgcagtcccggctgtggttc
gtccatcgtctcgatccggcgaacagcgcggcgtatcacgtcggtgggcagctgctcgtg
aagggacgcttcgacgcgaacgcgttctctcgcgcgctcgaagtgatcactgcaagacac
gacgccttgcgcacgacgttcgacgagcgcgatggcgtcgccgtccagatcgtgcatgcg
aaggccgacgtgccgctcgtgagccacgatgtgtcgggggacgcgaaccctgacgccgca
gcgactcgtctgaccgatgcgttactcgcacagccgtttgccctggacacgtgcgcgccg
tggcgcgttgcgtcgatccgcctatcggtcgaggcgcaccgaatcgtcttcgtcctgcat
catctgttgacggacgcgtggtcgatgaccttgctggtcgacgaactggcacgggcctac
agcggtttctccgatggcaagacaccggtgctggctccggtgccagtccagcccggcgat
cacgcccattggcagcatgcctgcgtcaacggcgaggcgcttggccgtcagctcgactgg
tggcaggcgcgtctgccggagccgtcgccggtgctcgcattgccggtcgaccgcacgcgt
ggcgcgttgcgcagcggcgcagggcaaacgctcgcgttcgaatttccggcggggctcacg
cgtgacgtactgaccttcgccgcgcaacgtaaagcgacgccgttcatcgtgctggccgca
tcgttccaatggctgctgcatcggtacgcgggcgagacggatatccgcgtgggcgtgccg
attgcgcagcgcgacgtgtcagggctggaacgcatgctcggctgtctcgtcaacacgcag
gtgtggcgcgcacagatcgacccggcagccgacttcgatgggttggtgacgcaggtgcgc
gatggggcgctggcagcgcaggcgcaccgcgaagccccgttcgagcgggtggtggagcgc
gtcgcgccacagcgcagcctcggacaatcgccgctgtttcaggtgatgttgaaccatcat
gtggcgaacgctgccgcgtcgcgcgccgcgacgggctggcccgcaggcctgagcgtggtc
gcacagccgctgaccggcggcgctcagtacgaccttgcgctcgatatcgacgagcttcat
gaggcgacggcgggcaagggcgctgatccgctcgacggcgtgacgctgcgcgcccgcctc
actttcccgacggatctgttcgacacgccgaccatcgagcgccttggtgcggactggtgt
gcgggactggcgacgctgctcgcgctcccgacacagccgctggcgtcgctcgacgttgcg
tttgaaagcgcgttggagggcgggcatcgcattgcgcacgccgaagacgcgttgccgttt
caaagtgtcccctcgctaatcgacgtgcaggcgcagcaacaaccgtccgccatcgcgttg
cgggatgaggctggcaccctcacgtacgccgaactcgtgcgcgcggcgaaccgcattgcg
cattggctgctggcgcagggcgttgcgccggaagcgcgcatcggactggcgatgtcgcgt
cagaccggcatgatcgcgggactgctcggcatcatgaaggccgggtgcgccttcgtgccg
ctcgatccgtcctatccggccgagcggctggcgcagatcatcgatgacgcgggtatttcg
ctggcgctcactgaagcctcgctggccgacgcgctctggctccccgtgcgtcgcgctgtg
gtagccgatctcatggcggatgccacgctgcccgaccatccaccagggggctcgctgcat
cccgatcaactggcttatctgatttacacctccggttcgaccggtaccccgaaaggcgtg
gcggtggcgcacggtccgctcgccatgcactgtgtggcgaccggcgcgcaataccgtctc
acgcccgaggtctgcgaactacacgtgctctcgatcaacttcgacggcgcgcacgaacga
tggatggcgccgatgatctgcggcgcgtcgttgtttattgcggacgaacgtcactgggcg
ccgcagacgatggtcgacgcgatgcgtcgtcacggcgtgacgaatgccgggttcccgacg
gcctatctgtgccgtcttgccacgagcggggcgaccggggcaccggcattgcgtttgctg
tcgttcggtggtgaagcaatggcgttgcccgcgctgcgcgcggcgcaggcgatgttccgt
ccggcgcagacgatcaacggttatggtccgacggagaccgtgatgacaccggtcgcctgg
tccatcgacggggtgctggatgcgcaaccggctgcacaaatcgcgggtcaggcgtatgcg
ccgatcggcgagccggtgggacgccgccgcgcgtgggtgctcgatccgtggctcggcgaa
gtgccgctcggcgcggtgggcgaactgtacctcggtggcgagggcgtggcacgtgggtat
ttcgcacgcgcagcgctgacggccgagcgcttcgtgccggacccgcgcggtgagccgggc
gcgcggatgtatcgcacgggcgaccgggtgcggcgactggccgacggcacgctcgtctac
ctcggccgtttcgaccagcaagtgaaggtgcgcggcttccgcatcgagccgggcgaagtc
gagacgcaattgctgcgcgaaccgggcgtcgacgacgcgctggcggtcgtcgcggcgggg
cctgcgggcgatcagctcgtcgcctacgtcgcaggcaagggactcggtggtgaagcgctg
cgcgtggcgctgtcgcgtcgtctgccggactatctggtgccgtcgctcgtgatcgtgctg
gattcgctgccgaaactccccaacggcaaacgcgaccgggcggcgctgcctgcgcccgta
tggggcagtgctggcggacaggcaccgcagggcgaggcggagtttgcgctggcggtcgtc
tggcaggatctgctgcgcgtgccgtcggtgagccgcgacgacaacttcttcgcgctaggc
ggcgattccatcgtcgcgttgcagatggtcggacgcgcacgtcaggcgggttggcaattc
ggcgcgcaagacgtcttccgtcaccagacgctcgtgcgtctcgcggcacaagcgagggcc
gtcggtgaaggggacggcgcggcgcgcgtgcccgaaccgctcgaaggtgaggtgccgctc
acgcccgtgcaggcgtggttcttccgtcagcctatcgcgtgccgcgatcattggaaccag
tgggtcgaagcgacgttgcccgtgggtacggacatgacggcccttcgtgaagcgctggcc
accgtcgtgaagcatcacgatgcgctccggctgcggttcaccgagcatgacggccaatgg
caggcgcgctacgtcgcgccgcatgccgccgacgatctgctctggcacgcggcgatgtgc
gacgacgcgcaactggccgatgccctcgctcaggcccagcgaagtctgtcgctggccgac
ggcccgctgttgcgcgcactgctggtgcgcacggaagcaggcgagttgcgctgtttcctc
gtcgcgcaccatctggtgatcgacggcgtgtcgtggcgcatcctgctggacgatttgcaa
acggcgctcgggaatacgcatggggagcgggcggtgcggacattgcccgtcgtcggcgaa
tcgatgcgcgcatgggcgcagcgctggcatgactggacgcaaagcgacgccgcatcggcc
gcgctggaggtctggcagcgggcgctggccggggccgtggagtcggtggacgttgccagg
ccaacgaacgcgacggtgggggcggtgggcacgggcgagatcgaacacacgtggcccgca
gacgtcgccgtgccgctcacgcaactgcgtcgtgttcgaatgcacgaagcgctgagtgcc
gccgtcgcccacacgctgggccagcgtgcaggggcgcagcgttatgtcgtccacgtcgaa
ggtcatggacgtggcggccaaggtggcggccaggagcagggcgacctgtcgcgcacgctc
ggctggttcacggcggcgtggccgctcgccattctggtaggtagcacccccgaagaaaca
ctggccgccgcgcgcgaagcctggcgatgcgtgccgcacgacggcgcgagctatgccgcg
ctgcgttaccttggcacgccgcaagcccgtcagacgctcgacgcgctgcccgcaggacac
gtcacggtcaacttcctcggacgtaccgacacggacggcatcgtcgacgggggcctgtcg
catgagcccgacgttgcgccgcccaactggctgacgctcgacgtctggcagcgcgacgac
acgctgcggctcgtctgccgctacgaccgcgcgcgcttcacaagcgacggcgttcagacg
ctcgtcgacgagatcggtgcgacgctgcgtgtgctggccgagacgctgcccggtcacgaa
ccggtcgtcgccgaagatttcccgtacgcgggcctcacgcgtgaacaactcgcgacattg
cccgcgtcgatgcaacagatcgaggccgtcgtgcccgcaacatcgatgcaacaaggcctg
ctgttctactcgcagcagcagggcaccgccgatccgtacttctatcagaagggcttcgtg
atcgacggcgcactcgatacgagcgcgttcgcacaggcatggcgggaggcggtcatgcgt
catgcggcgttgcgcacggcctatgtgagcgacgtcggcgaactgccgctgctgcttgtg
cacggacccgagacagtggctacggcaatcaatctgctgccgcaggaagactggtgcgcg
ttgagcgagacggaacaacacgcgcgtctggacgctcgtttcgcggccgagcgcgccgcc
ggattctcgttcgcgcaagcgaatcgtccgcgtctggcgttgattcgtgtcggcgagtcg
cgctggtggctgctgtggagcagtcatcacgtgacgctcgacggatggagcaccggcctg
attctgagcgacgtgatgtcgcgctatgcctcgctggcgaagggcggggtgtcgacggat
ggcgaggtgcaggtggcgccctcgtttgccgagtttgccgtgtggcaacgtgaattggac
gcccgcgcatcgctcgcgcattggcggcatttgctggacggcgtgggcgcgccgacgccg
cttcccgccgcacgtcaggcacgtcaggcacgtaggaccgatgagacgagtggacatggc
gaaaccgcatggacgctcgccccttcgcaatggcagacgtggtgcgacgcagcccgtcgc
gttggcgtgacgccaggcacgctgtgtcagggcgcatgggcgctgctgctggcgcggcat
gccggattgcgcgacgtggtgttcggcgtgacggcatcgggccgctctgcggccgtgccg
ggcatcgaacgcatggcgggtctgttcatcaacacgctgccggtgcgggcgacgctcgac
gcgcgtcgtccggttgccgactggctgcgcgaacttcagacgcaaacggcgcagtcgcgt
gagcatgagcatgtggcgctgtccgccatcacgcgcgaggcgcaacgcgacggccaaagc
gcggacggtgctctgttcgagagcatcgtcgtcttcgaaaactatccgctcgatgctgcg
ttgcttgcccagcgcgacgacggcctgcggctgtcactgctggagcgcggcacgcaggcg
cgcaacaactatccgctgtcgctgatcgtcgagcagcacgacggcttgcgtctcgtgctg
gcgttcgcacgtgagcgcttcgacgccgctgccgtgcaagccctcggcgagcacttcgtg
gcgttgctcggcgcggtggcggacagtcttggcacgtcgaccacgccgttggggcagatt
ggactgacgaacgcagtgccacagacggccgagaacgtcgtctggtcctcgcacgacttg
cttaacgactggcacgcgcatgtcgcccgtgacggcgcggcgctggccgccgaaggcgag
gacgcgagctatcggcgagacgaactcgacgcgctcgcgaatcgcctggcggcaacgttg
caggcgcaggggatcggtccggaggatcgtgtcgccatctgtgtgccgcgcagcgcagcg
ctggttggcgcgattctgggtgcgtggaaggccggggcagcctacgtgccgctcgaccct
gagcaaccggcggtgcgtctgcaaaagctggtgcgcgccagtggtgccaaagcggtaatc
gtcgacgatcggacacctgcgataacgcacccctcgctgattcgctggcgcgacattgcg
cacgccagcgtcgacacgaaagcgccgtcaccggtgcgcgtgcatccggcgcaggcggct
tacgtcatctacacctcggggtcgacgggcgagccgaagggcgtcgtcgtcagccgtggc
gcgctccataactacgtgcaggcggtggcagcgcgccttcgtgagcgcggtctcgatacg
gcaggtgagacgggcggattcgcgatggcttcgaccgtcgctgccgatcttggtcacacg
acgttgttcggcgcattggcgctcggccgtgcgctgtatctcgtgccacacgcatgcgcg
ttcgatgcgcagcgcttcgccgactggtgtgccgcgcgtccgatcgatgtgctcaagatc
gtgccgggtcacttgaacggcctgttcgacgcggcgggcgcggcggtattgccgcgcgcg
gtgctggtgacaggcggcgaatcgttggatccgtcgttcgtcgcacaaatccgtggggcg
cgtccgggactcgctgtcctcaaccattacggaccgacggagacgactgtcggggcactg
acgcatgctgtcggtgacattgcagaggtgcctgtgcctgtcgggcgtccgctggcgaac
ctgcatgcgcatgtcctcgatgctgacctgaaccctttgccgtcgggggtggccggtgag
ctttatctgggcggcgcgggtttggcccgggggtatctcggcgcgcctgcgcaaacggcc
gagcgtttcgtgccggacccgtggtgcgcaggcgcacgtctgtatcgcaccggtgatcgt
gcggtgcagcgcaccgacggtgccatcgtctacctcggccgcatggacgatcaggtcaag
atccgcggctatcgcgtggaaccggcggaggtggcgcaggcaatgcgttgcgtgcccggc
gtgatcgatgccgtggtcgttgcccgtcacgacgggccgggtggcgcatggttgcacggt
gtctttacgggcgaggcggggctcgacgtcgttcgcactgcgttgacgcaggcgctgccg
tccgcctggattccggcacgattcgacagtgtcgacaagctgccactgaccgcgaatggg
aaggtggatcgtcgcgctttgctggcgttgaccgagcgcgtcgatgccgcgaaggaaagc
gcggaagtggcgtcggtggaattgccacatgtcggcgcggaagccgacatcgcggccatc
tggtgtcaggtcctcaaacgcgagcaggtcggccgccacgaagcgttcttcgacatcggc
ggcgactcgattctggcgttgcaggtgattgcgcgactgcgtaagcgtggcatcaaggtc
gggccacagcatctcgcatcgcatccgacagtggcacaactggcgacgttggcggcgcct
gccgaagcgacgtctgcgcaaacgccgtcggccgtcagcgggccgacacgtggcgacgac
aatcgcagtacgttcccgctgtcgtcgtcgcagatgcgtgtgtggctggagacgcagatg
gcgccgcgcgccggggcctatcacatagccggtgcgttgcgactggatggggcgttgcaa
gccgacgcgcttgagcgcgctttgcagacgttgtcggactggcacgacgtgttgcgcacg
accgtcgcggtgaatgccaccgagggcggcgcccccgagcaacgcgtacatgccgcgctg
ccggtcgcgttcacacgcgacgccgtcgcccccgggatgtccggcgacgctaccagcgcg
cttgtgcaagcgcgtctcgaggcgctgacgctcgcgcagttcgatctggccaacgggccg
ctctggcgcgtccatctcatgcaactggacgaccagtcgcacgtgctgatgctggtcatg
catcacctgatctcggacggctggtcgatgaacctgctggtcgccgatctggcgcgtgcc
tatcgttcgcatgcgggcggtaggcagccggtgcgcgacgcgtgggcttcactgctgcgc
tacggcgattacgccgtgtggcagcgcgaacaactggccggtcccgcgcaagccgcacag
cttgcctactggtgtcagcagcttggcacgacgcacccggagctggccttgccgttcgac
cgcgcgcgccccgtcgttcgcgatggcgcaggggccagcgtcgacctcacgatgccgcca
gggttgcccgcgcgactcgaccgtttcgcgcgcgagcacggcgtgacccgtttcatggtg
atggccgcggctttccatctgctgctgcatcgcgtcaccggcgagggcgacgtgcgtacg
gggatgcccgtggccggacgcgcgcacgaggccgtcgaagcggtggtgggattcttcgtc
aacacgcaggtgctgcgctcgcaaatcgaatcgccgacgacgtttgccacgctcgtcacg
caggtgcgagaccaactgctgggggcgcagcagcatgccgacgtcccgttcgaacggttg
gtggaacacctcgcaccggtgcgcagcgtgtcacggcatccgttgttccaggtgtccatc
aatcaccagaagcgcgctttcgcaccgctgagcgatctggccggtgtgacgatgcaggct
atcgagcggcgtgcacatcatgcgcaggtcgacctcgcgctcgacacggaagaggacgaa
gcgggcgcactgcgcggctggctgacgtacgcctgcgacgtgttcgacgcaccgacggtg
cgccgcctcggcgagcaatggctggcgctgctggatgtcgccatgacacaggccacgaca
cctgtcgcgcggcttgcgatgacgacgggcgacgcagcgggccagcgcaacgataaaggc
cgtacgcgggtgagcgttgccgtgccgctgccggtacatgccgtgatcgacgcgcaggcc
gcagttcggcgtgacgcgattgccgtgtgcgacgccaacactcgcgtctcatacagcgaa
ctcgtcacccgggcaaaccgcgttgcccatgcactcattcgcgcgggcgtcgcgcccgag
gcgcgtgtcgggctggccatgtcgcgcagcacggacctgatcgttgcgatgctgggcatt
ctcaaggcgggcgcggcgtacgtgccgctcgatccggcgtatccggctgagcgcctgagc
ttcatggtggaagacgccggggtgacgcatgcgatcacgcaggcgtcgctggccggggcg
tcgtggttgccgggtgaggcaataaccttcgaatcgatgctcgccgacgcctcgctgccg
gagcacgccccgatgcgcgacgttcacgtcgatcaactggcttacgtgatctacacgtcc
ggctcgacggggcgtccgaagggcgcgcaactgacgcatcgcaacctgatgcggttgctc
acggggacatcgcaggacttcgccttcgatgcgaacgacgtctggacgatgttccattcg
tacgccttcgatttctcggtctgggaaatcttcggtgcgctcgcgcatggtgcgcggctc
gtggtcgtgtcgcaggacacgacgcgcgatccggcggcgatgtggaaactcgtcgccagc
gaaggcgtgacggtgctcaaccagacaccctcggcgttctatcaatggcttggagcaatg
ccgtcggacgctatgtcgacgacgctgcgccacatcgtcttcggcggcgaagcgctcacg
cccgcgcgactcgctgcgtggtggcagcggtttggtgaagcgacgcgtctgaccaatatg
tacggcatcaccgagacgacggtgcacgtcagtcagcacgtgctgcatcggggcgacacg
gcgggttcacccatcggtgagccgattgccgacctcgactggcgcgtactggacgcaggt
ctgaacgaagtgccgccgggcgtcgcaggcgatctgtacgtgtgcggcgacggactggcg
cgtgggtatctggggcaggcgggcctcacggccgagcgcttcgtgccggacccgaagggc
gcaccgggcgagcgcatgtatcgcagcggcgaccgtgcgcgtcgactggcggacggcacc
ctcgactacctcggccggggcgatgcacaggtcaagctgcgaggcttccgcatcgagctg
ggcgaaatcgagtcgcaactgctgcgtcacgaagacgtgacggacgccgccgtcctcgtg
cgggacgacggcgcgggcgagcaactggtggcgtacgtggtgttgtcgccggagcgtatc
gccgacgtcgataccgcagcgttgtggtcgcgtctgcgcgcccatctgggcggtgcgttg
cccgcttacatggtgccgggccagtggctacgtctggacgccttgccgctgaccccgaac
ggcaagctcgaccggcgcgcgttgccggtgcctgaagccgctggtgcggcgcagttcgag
gcaccgcgcgacggcaacgaagcgcgcatcgcttcgatctggcaggaagtgctgggcgtg
ccgcgcgtggggcgtcacgacgacttcttcgcgcttggcggtcactcgctgctggcaacg
caagtggcgtcacggctgcgcgatgcattgtcgctcgacgtaccgctgcgcaccctcttc
gaagcgagccgattgacggcgttggcgcaagccctcgacgcgatgaccggcgcgtcaccc
gccagcccggcgctcgccgacgacgacttgcaagccgccctgcgcgaaatggaatccctt
tctcccgatgcgctgcaagcgctgctcgggccggacgcaactcatggcgcaattcatggg
caatctaagcatggctga

DBGET integrated database retrieval system