KEGG   Pandoraea sputorum: NA29_17500Help
Entry
NA29_17500        CDS       T03554                                 

Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
pspu  Pandoraea sputorum
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pspu00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    NA29_17500
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    NA29_17500
Enzymes [BR:pspu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     NA29_17500
Peptidoglycan biosynthesis and degradation proteins [BR:pspu01011]
 Precursor biosynthesis
  Racemase
   NA29_17500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(4005654..4006724)
Genome map
AA seq 356 aa AA seqDB search
MPRPIKASIHTAALAHNLDVARRHAPNSKVWAVVKANAYGHGIENAYPGLRDTDGFGLLD
LDEAVRLRELGWAGPILLLEGFFKPEDLAIVDKYGLTTTVHSDEQLRMLETTRLTKPLNI
QLKMNSGMNRLGFAPERFRAAWERARAIPGVSQIVLMTHFSDADGERGIAHQMETFERGA
CDVPGERSLSNSAATLFHPTAHGAWVRPGIMLYGSSPKGLEVTAAQLDLQPTQTLEAELI
GIQDVPAGGSVGYGSSFVAQTPMRVGTVACGYADGYPRVAPTGTPILVDGVRTRTVGRVS
MDMLSVDLTPVPQARVGASVTLWGRGLCIDEVAASAGTLGYELMCAVARRVPIHAV
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgtccaatcaaagcttcgattcataccgcagcactcgcccataatctcgatgtc
gcccgccgtcacgcccccaacagcaaagtctgggcggtggtcaaggccaatgcctacgga
cacggcatcgaaaacgcttaccccggattgcgtgacaccgatggtttcggcctgctcgac
ctcgatgaggccgtgcgcctgcgagagctgggctgggctggtccgatcctgctgctcgaa
gggttcttcaagcccgaagacctcgccatcgtcgacaagtacggtctgacgaccacggtg
catagcgacgaacagttgcgcatgctcgagaccacgcggttaacgaagccgctcaatatc
cagctcaagatgaactccggcatgaaccgcctcggtttcgcgccggagcgctttcgcgcc
gcgtgggagcgcgcacgtgccatccccggtgtgagtcagatcgtgctgatgacgcacttc
tccgacgccgacggcgagcggggcatcgcgcaccagatggagacgttcgagcgcggcgct
tgcgacgtgccgggcgagcgcagcctgtctaactcggccgccacgctgttccatccgact
gcgcatggtgcgtgggtgcgccccggcatcatgctctacggttcttcgccgaaggggttg
gaagtcacggccgcgcaactcgaccttcagccgacgcagacactcgaagccgaactcatc
ggcattcaggacgtgcctgccggtggctcagtgggctacggcagttcgttcgttgcgcag
acgccgatgcgcgtaggcaccgtggcatgtggttatgccgacggctatccgcgtgtcgcg
cccacgggtacgccgattctggtggacggcgtgcgcacgcgcaccgttggccgcgtatcg
atggacatgttgtctgtcgatctcaccccggtgccgcaggcgcgcgtgggggcgtccgtt
accttgtgggggcgcggcctgtgcatcgacgaagtcgccgcctcggctggtacgctgggt
tatgaactgatgtgtgcggtggcgcgtcgcgtaccgatccacgccgtctga

DBGET integrated database retrieval system