KEGG   Punctularia strigosozonata: PUNSTDRAFT_107209Help
Entry
PUNSTDRAFT_107209 CDS       T03131                                 

Definition
(RefSeq) heme peroxidase
Organism
psq  Punctularia strigosozonata
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase
Motif
Other DBs
NCBI-GeneID: 18876071
NCBI-ProteinID: XP_007387334
JGI: 107209
LinkDB All DBs
Position
Unknown
AA seq 1070 aa AA seqDB search
MSSPNLVSGVLKGLGDVTGNLHKSFEPYDTDGARPVPGPLTRHIDDLAQIAERGSAFTPA
DLPAYVDAVKNLNGVGLDDRKLLLEKLVTLMSRLPDGNLFGKKLQDFFIDTLYNDLPHPP
AGYLSLPAAGYGATALPPQRVPYAYRSADGSNYNPLFPDMGKAGTPYARSVPSKITVPRS
ALPDPGLVFDTLLARQKFTPHPGGISSLFFALANLIIHSCFHTNARDWTINDASSYLDLS
PLYGSSDAELDQIRTHDGSGRIHPDTFMDSRILFMPPSTNALLVLFNRNHNWIASKILAI
DEWGKYAPPASLADAAAAAKREAQDAEIFHRARLVNTGFFMQAILRDYVGAILGCVRDGS
AWRLDPLAAFRDLSHEVSPRGEGNVVSLEFNLLYRWHATSSAQDTQWTEAEFGKLFDGKD
FRTITVDDFRRAAMTKLDPRKLPPFTEWTFNGLERGADGRFADDDLAKILQDATEWPAGA
FGAQGIPDVLRVVEMLGIAQSRTWGACSMNEFREFMGLKPYSTFAEWNPDPAVHKAAEAL
YHHIDNLELHVGIQAEQTKDPMPGAGLCPGYTISRAILSDAVCLTRGDRFLTVDFTPFNL
TSWGYQHCQADGDDGSYGGTLAKMLFALLPEHYPAGSAYGHFPFMVPETMRGFMKDRNDP
DVDKYTWSRPSVPVPTAVVDTYDGAKLVLGNPRLFASTYERHLFNVAGTSSEAAALVNSV
LTSDDMTQQWKRSAYVTAVSLIQRKTFEQVKSTARYVDVVKDVINLVPVHLIANELVGLP
MKTEDNPHGVYREDQLYDQFAEVCNYVFVDADNFVDWRLREHSIATLKDVLDYAKGHFTK
LTKGLLSFGGLSDTVVQYVAGRNDNSERFLRKLLDGRRGLSDDSLAAGLASIVATAAHFS
AALANVVDFYLDDGQREARDDIVRLANVHSVQADHQLLQYALEALRLKPAVAAVYRTASA
NGQVGTTSVQPGQKVFVNVTKANQEASHGQEPGIFDVGEHGFMSQKFFEVAAPSVLRAVF
RLPQLKRAPGLSGVLNSFTETVYDTQITSYINSKGETTPFPPSLVVHYSL
NT seq 3213 nt NT seq  +upstreamnt  +downstreamnt
atgtccagccccaacctcgtctccggcgtgctcaagggcctcggcgacgtcaccggcaac
ctccacaagagcttcgagccgtacgacaccgacggcgcgcgccccgtcccgggcccgctc
acccgccacatcgacgacctcgcgcagatcgccgagcgcggctccgcgttcacccccgca
gacctgccggcgtacgtcgacgcggtgaagaacctcaacggcgtcggcctcgatgaccgc
aagctcctcctagaaaagctcgtcacgctcatgtcccgcctccccgacggcaacctgttc
ggcaagaagctccaggactttttcatcgacacgctctacaacgacctcccgcacccgccc
gccggctacctctccctccccgccgccggctacggcgcaacggcgctcccgccccagcgc
gtcccgtacgcctaccgctccgccgacggctccaactacaaccccctcttcccggacatg
ggcaaggccggcacgccctacgcgcgctccgtcccgtccaagatcaccgtcccgcgctcg
gcgctccccgaccccggcctcgtcttcgacaccctcctcgcccgccaaaagttcaccccg
cacccgggcggcatctcctccctcttcttcgcgctcgccaacctcatcatccactcgtgc
ttccacaccaacgcccgcgactggacgatcaacgacgcctcctcctacctcgacctcagc
ccgctctacggctcgtccgacgccgagctggaccagatccgcacgcacgacggctcgggc
cgcatccacccggacacgttcatggacagccggatcctgttcatgccgccctcgacgaac
gcgctgctcgtcctcttcaaccggaaccacaactggatcgcgtccaagatcctcgccatc
gacgagtggggcaagtacgccccgcccgcgagcctcgccgacgccgccgcggccgcgaag
cgggaggcgcaggacgccgagatcttccaccgcgcgcggctcgtcaacaccggcttcttc
atgcaggccatcctccgcgactacgtcggcgccatcctcggctgcgtccgcgacggctcc
gcctggcgcctcgacccgctcgccgccttccgcgacctctcgcacgaggtctccccgcgc
ggcgagggcaacgtcgtctcgctcgagttcaacctgctctaccgctggcacgcgacgtcc
tccgcgcaggacacccagtggacggaggccgagtttgggaagctgttcgacggcaaggat
ttcaggacgatcaccgtcgacgacttccgccgcgcggcgatgaccaagctcgacccgcgc
aagctgccgccgttcaccgagtggacgttcaacgggctcgagcgcggcgcggacggaagg
ttcgcggacgacgatctcgccaagatcttgcaggatgcgacggagtggcccgcgggcgcc
ttcggagcgcaaggaatcccggacgtgctccgcgtggtggagatgctggggatcgcgcag
tcgaggacgtggggcgcgtgcagtatgaacgagttccgcgagttcatgggcctcaagccg
tattcgacatttgccgagtggaatcccgatccggccgttcacaaagcggcagaggcgttg
taccaccacatcgacaacctcgaacttcatgtcggcattcaagccgagcaaacgaaggac
cctatgcccggcgccggcctctgcccggggtacaccatctctcgtgcgatcctgtccgac
gccgtctgcctgacacgaggagatcggttcctcacagttgactttactcccttcaacctc
acgtcgtggggataccagcactgccaagccgacggcgacgacggctcgtacggcggcacc
ctcgcaaagatgctgttcgctctcctgcccgagcactaccccgccggctccgcttacggt
cacttcccgttcatggtgccggagaccatgcgcggcttcatgaaggaccgcaacgacccg
gacgtcgacaagtacacttggtcgcgcccgtcggtccccgtcccgacggccgtcgtcgac
acgtacgacggcgccaagctcgtgctcggcaacccgcggctgttcgcgtcgacgtacgag
cggcacctgttcaacgtcgccgggacgtcgtccgaggcggccgcgctcgtgaactccgtc
ctgacgtcggacgatatgacgcagcagtggaagcgctcggcgtacgtcaccgcggtgtcg
ctgatccagaggaaaactttcgagcaggtcaagtcgacggcccgctatgtggacgtggtg
aaggacgtgatcaacttggtgcccgtgcacctcatcgcgaacgagctagtcggtctgccc
atgaagaccgaggataacccccacggagtctacagggaagaccagctgtacgatcaattt
gcggaggtctgcaattacgtcttcgtcgacgccgacaacttcgtcgattggaggttgcgc
gagcactcgatcgcgactctgaaggacgtcctggactacgccaaggggcacttcaccaaa
ctcaccaagggtctcctatctttcggcggcctttccgataccgtcgttcaatacgtcgcg
gggcgcaacgataactcggagcggttcctccggaagcttctggatggtcgccggggcctg
tcggacgacagcctggccgcaggccttgcgagcatcgtagccaccgccgctcacttctcc
gccgccttggcgaacgtggtggacttttaccttgatgatggccagcgcgaggcgcgggac
gacatcgtccggctcgcgaacgtgcacagcgtccaggcagaccatcagctccttcaatac
gcgctggaggcgctccgcctcaaacccgcggtcgccgccgtctaccggaccgcttcggcg
aatggccaggtcgggaccacgtccgtgcagccggggcagaaggtcttcgttaacgtgacg
aaggcaaatcaggaggcttcgcacggtcaagagccaggaatcttcgacgtcggcgagcat
ggcttcatgagccagaaattcttcgaagtcgccgctccgtccgtcctgcgggccgtgttc
aggctcccgcaactgaaacgtgcgccagggctttcgggcgttctgaacagcttcaccgag
accgtttatgatacgcagatcacgtcgtacatcaacagcaagggcgagaccactcccttc
ccgccgtcgctggtggttcattactcgttgtag

DBGET integrated database retrieval system