KEGG   Punctularia strigosozonata: PUNSTDRAFT_140113Help
Entry
PUNSTDRAFT_140113 CDS       T03131                                 

Definition
(RefSeq) histone deacetylase complex catalytic component RPD3
  KO
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
psq  Punctularia strigosozonata
Brite
Enzymes [BR:psq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     PUNSTDRAFT_140113
Chromosome [BR:psq03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     PUNSTDRAFT_140113
   HDAC complexes
    Sin3A-HDAC complex
     PUNSTDRAFT_140113
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    PUNSTDRAFT_140113
  Chromatin remodeling factors
   NuRD complex
    PUNSTDRAFT_140113
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
LinkDB All DBs
Position
Unknown
AA seq 522 aa AA seqDB search
MTESAPAPASEKWLSVDNEKKRVCYFFDSDIGGFHYGPGHPMKPTRIRMCHSLVMNYGLY
KKMEIFRAKPATKREMTQFHTDEYIDFLGRITPSNMNAYIKEQHKYNVGDDCPVFDGMFD
YCSISAGGSMEGAARLSRDKCDIAVNWAGGLHHAKKSEASGFCYVNDIVLGILELLRYHS
RVLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKYGEFFPGTGDIRDIGIGKGKHYALNFPL
RDGITDESYKSVFEPVIRQVMESYDPAAIVLQCGTDSLSGDKLGCFNLSMRGHANCVKFV
KSFNKPLLLLGGGGYTMRNVSRAWAFETGLAAGVELGPNIPVNEYYDYFGPTYELDVKPS
NMEDLNTRRYLDRVKGMVFENLRAIGGPPSVQMQDIPRVPIDDHMDDIRADDDLISPDER
RPQRLLDYRRQPEGELSDSDDEGEGGRRDRTSHREGNGEVHAQPAGRPPTGIMRTGSTGG
AGPSAHGQGVVLTTLPATSEEVEETKPEPMEVDVEAAIAPAT
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgacggaatctgcaccagcccccgcgtccgaaaaatggctttccgtcgataacgagaag
aagcgggtgtgttatttcttcgattctgatattgggggctttcattatggccctggacac
ccgatgaaaccaactcgaatacgcatgtgccactcactggtcatgaactacggcctgtac
aagaaaatggagatctttcgcgccaagccagcaaccaagcgtgaaatgacccagtttcac
actgacgagtacatcgacttcttgggccggataactcctagtaatatgaacgcatatatc
aaggagcagcataaatacaatgtgggcgacgactgtcccgtcttcgacgggatgttcgac
tactgttcgatatctgctggtggttcaatggagggagcagcgcgactgagccgcgataaa
tgtgacattgctgtcaattgggcaggcggcctccatcacgcgaagaaaagcgaagctagc
ggtttttgctacgtcaacgatattgtgcttggcatcttggaactactcaggtatcacagc
agggtactttacattgacatcgatgttcatcatggcgacggagtggaagaagcattctat
accactgaccgtgtgatgacctgctcattccacaagtatggggaattcttccccggaacc
ggtgacatacgggatataggaatcggcaagggaaaacattatgcgctgaacttcccgttg
cgagatggtatcactgatgaaagttacaagagcgtattcgaaccggtcattcgacaggta
atggagtcttacgatcctgccgcgatcgtgttgcaatgcggtacggattcactctcagga
gacaaactcggttgcttcaacctctcgatgagagggcacgccaactgcgtgaaatttgtc
aagtcattcaacaaaccactgctgcttctcggcggtggcggctacaccatgcgcaacgta
agccgagcatgggcgttcgaaacagggctggcagcaggcgtagagctcggccctaatata
ccggtcaacgagtactacgactacttcggacctacctatgaacttgacgtgaaaccctct
aatatggaagacctgaatacgcgaaggtatcttgaccgtgtgaagggcatggttttcgag
aacttgcgcgcaatcggtggtccaccgagcgtccaaatgcaagacataccgagagtccct
atagacgaccacatggacgatatacgggctgatgacgacttgatttcaccggacgagcgc
cggccgcagagattactcgattaccgacgacaacctgaaggggaactttcggactcagat
gacgaaggagaaggaggtagaagggaccgtacttctcatcgcgaaggcaatggagaagtc
cacgcccagcctgcagggcgtccacctactgggatcatgaggactggatctactggcggc
gccggtccgagcgctcatggtcagggcgtcgtcctgacgacgttaccagccacgtcagaa
gaggttgaggagactaaacctgaacctatggaggtcgatgtggaagctgcgatcgccccc
gcgacgtga

DBGET integrated database retrieval system