KEGG   Pseudomonas stutzeri DSM 4166: PSTAA_2683Help
Entry
PSTAA_2683        CDS       T01976                                 

Gene name
sodC
Definition
(GenBank) superoxide dismutase, Cu-Zn
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
psr  Pseudomonas stutzeri DSM 4166
Brite
Enzymes [BR:psr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     PSTAA_2683 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2872200..2872721
Genome map
AA seq 173 aa AA seqDB search
MKQWIIAALAGCTALAAQAETLSVKVNAVTAQGIGESVGSVKIESSEYGLVFRPELTGLQ
AGLHGFHIHAKGSCEPAEVDGKPTAAGAAAGHWDPKNTGKHGEPWGDGHMGDLPALYVDS
DGKASQPVLAPRLKSLGDIKGLALMVHQGGDNHSDHPQPLGGGGARVACGVIE
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagtggatcatcgccgcgctggccggctgcaccgccctcgccgcccaggcggaa
accctgagcgtaaaggtcaacgccgtcaccgcccagggcattggcgaatccgtgggcagc
gtaaagatcgagagcagcgagtacggcctggtgtttcgccccgagctgaccgggctgcag
gccgggctgcacggctttcatatccacgccaaaggcagctgcgagccggccgaggtagac
ggcaagccgactgccgccggtgccgccgccggccactgggatccgaagaacaccggcaag
catggcgagccctggggtgatggacacatgggcgacctgccagcgctctacgtagacagc
gacggcaaggccagccaaccggtactggcgccgcgcctgaagagcctgggtgacatcaag
ggcctggcgctgatggtccatcagggcggcgacaatcactccgaccatccgcagcccctg
ggcggtggcggcgcacgtgtcgcctgcggcgtaatcgaataa

DBGET integrated database retrieval system