KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102447502Help
Entry
102447502         CDS       T02980                                 

Gene name
NEU2
Definition
(RefSeq) neuraminidase 2
  KO
K12357  
sialidase-2/3/4 [EC:3.2.1.18]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:pss00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    102447502 (NEU2)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    102447502 (NEU2)
Enzymes [BR:pss01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     102447502 (NEU2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
LinkDB All DBs
Position
Un
AA seq 382 aa AA seqDB search
MASPMPFPFNLRENMFQEEQPHYRIPALLYIQKSHTILAFAEQRGGEKDESAKLIVMHRG
TYNETTHAVQWEKVKTIVKAPLGDHRPMNPCPVYDEVTGNVVLVFIAVEGNISEQHQLDK
KENKARLCQVTSADNGVSWSPVTDLTDTDTVPKAWATFAVGPGHGLQLNNEVKSLVIPAH
AYWIHENSSPSPHPFCFVSDDHGKTWKRGNFLSEKKAGECQVVELRSQGKSVLYCNARSK
ERARVQAVSYNEGRDFPSDQQCKIQNLVEPPEGCHGSVIGFPRPAGVQSEEDTWVLYSHP
IDRNERKDLGVYLNKEPLNPESWTEPTVIYKGYCAYSDLQYMGPGPDGSPLFSCLFESGT
KSNYEKILFFMFTLKQVFPYDC
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggccagcccgatgcctttccctttcaacctgcgagaaaatatgttccaagaggaacag
ccgcactatcgaatcccagccctgctctacattcagaagtcccacaccatcctggctttc
gccgagcagcgggggggtgagaaggatgaaagcgccaagctgatagtcatgcacagaggc
acgtacaatgagactacgcacgccgttcagtgggaaaaagtgaagaccattgtcaaggct
ccactgggtgaccaccgccccatgaacccatgtcctgtgtatgatgaagtcactggaaat
gtcgttctggtctttatagctgtcgagggaaacatctctgagcaacaccagctcgacaag
aaggaaaacaaggcccgtctgtgccaggtcaccagcgctgacaatggagtctcctggagc
cctgtgacagatctcactgacactgacacagtgcccaaggcctgggctacctttgcagtg
ggaccaggccacggtttacagctaaacaatgaggttaagagtctagtgattccagcacat
gcctattggatacatgaaaatagttctccgtccccccaccccttctgctttgttagtgat
gaccatgggaagacctggaaaaggggaaactttctgtcagagaagaaagctggggaatgc
caggtggttgaattgaggagccaaggaaagtcagtgctgtactgcaacgctagaagcaaa
gagagagccagagtccaggctgtgagctacaacgaggggagggattttcccagtgaccaa
cagtgtaaaattcagaatctggtagaacctcccgagggctgtcacgggagtgttattggc
ttcccaagacccgctggtgtgcagtcagaggaggacacgtgggtcctctattctcacccc
atagaccgtaacgagcggaaagatttaggtgtgtacctcaacaaggaacccttaaatcca
gaaagctggacagaacccactgtcatctacaagggctactgtgcttattcggatctgcag
tacatggggccaggccctgatggctcacccctgttctcctgcctctttgagtctggtacc
aaatccaactatgagaagatcctcttctttatgttcactctgaaacaagtctttccatat
gactgctga

DBGET integrated database retrieval system