KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102448259Help
Entry
102448259         CDS       T02980                                 

Gene name
TMPRSS9
Definition
(RefSeq) transmembrane protease, serine 9
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Brite
Enzymes [BR:pss01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     102448259 (TMPRSS9)
Peptidases [BR:pss01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   102448259 (TMPRSS9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Ldl_recept_a
Motif
Other DBs
NCBI-GeneID: 102448259
NCBI-ProteinID: XP_014430299
LinkDB All DBs
Position
Un
AA seq 656 aa AA seqDB search
MEQRDPALKPVPDRERVRLAARSTCCKVTIAAVLVGGFALLSLGILMARGSAQGLSFEHT
AELRGIAYDRSLQRRNSDYSQTLTPALERLFLTSFRGSPLEGSCLGCAILEYSGFCGSRL
RFSPSAAWSLSPSVEEEALRHGLAAALREQGIPLASYGTIASASLTGPSRPAPYGLELKS
GTSSPCLGARPAPSPADPRRCPGNVFVCHNNPECDGQADCADGSDEADCGRTRLDYLRAD
LGTTSLSGADGSALSVSIKQVVQHPSYNPLLLDFDVAVLELAPPLRFSKYIQPVCLPLAV
QKFPVGKKCMISGWGSVREGNISKPASLQKASVGIIDQKTCNVLYNFSLTERMICAGFLE
GRVDSCQKASVGIIDQKTCNVLYNFSLTERMICAGFLEGRVDSCQAATSADCPGSEPPAP
SGPRQRTWRASHRAPSRKPGHRAQGRGWARPEHLQASSQGPSCSLPSHSYSDPKMWVAVL
GTPFLSGMDGRAEKIFHIHKHPFYNVYTLDYDVALLELATAVRLTSTIRPICLPDNSHVF
REGARCVITGWGATKEGGLMSKHLQKAAVSVMGEQACRKFYPIQISSRMVCAGFPQGTID
SCSGDAGGPLACREASGRWFLAGITSWGYGCARPFFPGVYTKVTAVRGWIGQSLKL
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaagggacccagctctaaagccagtgccggacagagagagggtgaggctggca
gctcgcagtacctgctgtaaggtaaccatcgcagctgtactcgtgggtggctttgctctt
ctttccctgggcattctaatggcgcgcggctccgcacaggggctcagcttcgagcacacg
gcggagctgcgagggatcgcgtatgaccgcagcttgcaacggaggaactcggattactcc
cagacgctgacccccgctctggaaaggctgtttcttaccagcttccgaggctcgccgctg
gaagggagctgcctcggctgtgccatcctggagtacagtggcttctgcgggtcccgcctg
cgtttcagcccctctgctgcctggtctctgagccccagtgtggaggaagaggccctcaga
cacgggctggctgcagcactgagggagcagggcatccccctggccagctatgggaccatc
gcctcggcctctctcacagggcccagcaggccagctccctacggactcgaattgaaatca
ggtacgagctctccctgcctcggtgccaggccagccccctccccagcagacccccgcagg
tgcccagggaacgtgtttgtctgtcacaacaatccggagtgcgatggccaagccgactgc
gccgatggctccgacgaggcagactgcggtaggaccaggctggactatctgagagccgac
ctgggcaccacgtccctgagcggcgccgacggcagcgcgctgagcgtcagcatcaagcag
gtggtgcagcacccctcctacaacccgctgctgctggacttcgacgtggccgtgctggag
ctggccccccccctgcgcttcagcaagtacatccagcccgtgtgcctgcccctggccgtg
cagaagttccccgtgggcaagaagtgcatgatttccggctgggggagcgtccgggaaggc
aacatcagcaagcccgcgagcctgcagaaagcctccgtcggcatcatcgaccagaagacc
tgcaacgttctctacaacttctccctcaccgagcggatgatctgcgctggcttcctggag
ggcagggttgactcgtgccagaaagcctccgtcggcatcatcgaccagaagacctgcaac
gttctctacaacttctccctcaccgagcggatgatctgcgctggcttcctggagggcagg
gttgactcgtgccaggctgctacgtcagcagactgccccgggtcagagcccccagccccg
tcgggtcctaggcagagaacctggagagccagtcacagggcaccatcacggaaaccaggg
cacagggcacagggcaggggctgggcccggcccgagcacctgcaggcctcctcccaaggg
ccctcctgctctctcccatcccacagctacagcgaccccaagatgtgggtggcggttctg
gggacgcccttcctgagcggcatggatgggagggccgaaaaaatcttccacatccacaag
cacccgttctacaacgtctacacgctggactacgacgtggcgctgctggagctggccacg
gccgtgcggctcaccagcaccatccggcccatctgcctcccagacaactcccacgtcttc
agggaaggggcccggtgcgtcatcaccggctggggggccaccaaggaaggaggcctcatg
tccaagcacctgcaaaaggcagccgtgagcgtcatgggcgagcaggcctgcaggaagttc
taccccatccagatcagcagccggatggtgtgcgccggcttcccgcagggcaccattgac
agctgctcgggcgatgcagggggccccttggcctgcagggaagcctcaggacgatggttt
ctggctggaatcacaagctggggctatggctgcgcaaggcctttcttccccggcgtctac
accaaggtcacggccgtgcggggctggatcgggcagagcctcaagctgtga

DBGET integrated database retrieval system