KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102448950Help
Entry
102448950         CDS       T02980                                 

Definition
(RefSeq) trypsin-3-like
  KO
K09640  
transmembrane protease serine 9 [EC:3.4.21.-]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Brite
Enzymes [BR:pss01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     102448950
Peptidases [BR:pss01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   102448950
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 466 aa AA seqDB search
MDDRIYCGGSLVDRKWVMTAAHCSKDIRSVQVLLGDYDLQTYEGTEQIRGVKNVIVHPGY
NSGLKDNDFMLLELDEPAELNNNVKTIGLATQCPAPGTKCTVSGWGTVTTPQLKFTPILQ
CADIYSVSQDSCKESYKDLITENMLCAGVEQGGRSSCRGDSGGPLVCNGMLQGVVSWGTA
VCAQRGYPGVYANVCKAVHKPATSTTLPIATAAMQLLILAMLVAGAAAAALQGGERIVPG
GKPCIPGSRPYQVALVKDGHIHCGGSLVEKKWVLTAAHCNKDLGSVRVHLGDYNLRTNEG
TEQFRRVKNVIVHPEYNRRPRDNDFMLLELDEPAELNNDVKTISLATQCPAPGTKCIMSG
WGSITSPQLTFPNELQCVELYSVSQDSCKERYRGLITENMLCAGVEEGGRDSCEGDSGGP
LVCDGILQGVVSWGTDVCALPKRPGVYANVCKAVQWVTDTIRDRPN
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggacgaccgcatctactgtggcgggagcctggtagacaggaagtgggtgatgactgcc
gcgcactgcagcaaagacatcaggtcagtgcaggtgcttctgggggattatgacctgcag
acgtacgaaggcacagaacagattcgaggagttaaaaatgtcatcgtgcacccggggtat
aatagcggccttaaggacaacgacttcatgctcctggagttggatgaaccggctgaactc
aacaacaacgtgaaaacaatcggcctggcgacccagtgtcctgcgcctggaacaaagtgc
actgtgtcaggatggggcaccgtcacgaccccgcaactgaagttcacccccatcttacag
tgcgcagatatctacagcgtcagccaggacagctgcaaggagagttacaaagacttgatc
acagagaacatgctctgcgctggtgtggaacagggcgggagaagctcatgccggggtgat
tctggaggcccactggtctgcaatggtatgctgcagggcgtggtctcctggggaacagcc
gtctgtgcccagcggggatatcctggggtctacgccaatgtctgcaaagccgtccataaa
ccagcgacgtcgacgactcttcccatcgccacggccgccatgcagctcctgatcctcgcc
atgctggtcgccggggcagcagcagcagccttacagggaggggaacgcatagtccctggt
gggaagccctgcatccccggctcccggccctaccaggtggctctcgtgaaggacggccac
atccactgcggcgggagcctggtagagaagaagtgggtgttgactgccgcgcactgcaac
aaagacctcgggtcagtgcgggtgcatctgggggattataatctgaggacaaacgaaggc
acagaacagtttcgaagagttaaaaatgtcattgtgcacccggagtataatcgacgcccc
cgggacaacgacttcatgctcctggagttggatgaaccagctgaactcaacaacgacgtg
aaaacaatcagcctggcaacccagtgtcctgcgcctggaacaaagtgcatcatgtcagga
tggggctccatcacatccccccaattgaccttccccaatgaattacagtgcgtagagctc
tacagtgtcagccaggacagctgcaaggagcgttacaggggcttgatcacagagaacatg
ctctgcgctggcgtggaagagggcggcagagactcatgtgagggcgattccggaggccca
ctggtctgcgacgggatattgcagggcgtggtctcctggggaacagacgtctgtgccctg
ccaaaacgacctggggtctacgccaatgtctgcaaagccgtccagtgggtgacggacacc
ataagggacaggcccaactaa

DBGET integrated database retrieval system