KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102451657Help
Entry
102451657         CDS       T02980                                 

Gene name
B3GALT4
Definition
(RefSeq) beta-1,3-galactosyltransferase 4
  KO
K03766  
beta-1,3-N-acetylglucosaminyltransferase 5 [EC:2.4.1.206]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
Glycosphingolipid biosynthesis - lacto and neolacto series
Metabolic pathways
Module
Glycosphingolipid biosynthesis, lacto-series, LacCer => Lc4Cer
Glycosphingolipid biosynthesis, neolacto-series, LacCer => nLc4Cer
Brite
KEGG Orthology (KO) [BR:pss00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    102451657 (B3GALT4)
Enzymes [BR:pss01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.206  lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase
     102451657 (B3GALT4)
Glycosyltransferases [BR:pss01003]
 Glycan extension
  Type 2 chain/Poly-N-acetyllactosamine
   102451657 (B3GALT4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
LinkDB All DBs
Position
Un
AA seq 368 aa AA seqDB search
MFCRLRTHQWCFIIFNIMLFHSLLFGGDLLEKYFLRSLPVTYTDMKILQIREKARKLDMD
PLKTNISKSFIISSSEVCSDQEVFLLTIVSSSPANRTRRNLIRQTWGNVTGIRGYAVLIL
FALGKPVSEAMQLDISEESQNHGDIIEGNFLDSSENQTLKIVMSMEWTLAFCSNAKFLLK
TDEEIFVNIASLADYLLNLKTHLEDIYIGRVIHQEVPDRDPQSKGFVSLSQYQEQYYPDY
CSGTAFVISQDVVRKIYVVAKETILLVPPDVFVGICAKNAGIIPIQSSRFSGKKHIRYNR
CCYKFIFTSSGMEDDEILKEWREISDGKDCTLLETYYGLVSCRVLTYFDKFKHFNIETIK
NEAFRFTN
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgttctgcaggcttcggacgcaccaatggtgttttattatattcaacatcatgcttttc
cattctttgctgtttggaggagatttactggagaaatactttctacgttcactacctgtt
acctacacggacatgaaaattctccaaatcagggagaaggccagaaaattagacatggat
ccactaaagaccaatatctccaagtcttttatcatcagcagctcagaggtgtgctcagat
caagaggtatttctacttactattgtgtccagcagcccagcaaacaggacaaggcgtaac
ctgatcagacaaacatgggggaatgtgacaggcatcagggggtatgctgtgcttattttg
tttgctttaggaaagccagtttcagaagccatgcagttagatatcagtgaagagtctcaa
aaccatggagacatcattgaaggaaacttccttgattcttctgagaatcagacactgaag
attgtgatgagcatggagtggactctagcgttctgttccaatgcaaaatttcttctcaaa
accgatgaagaaatatttgtcaacattgcaagtttggctgactacttgcttaatttaaaa
acacatcttgaggatatttacattggaagggtcattcatcaagaggtgcctgacagagac
cctcaaagcaaaggctttgtttctctcagtcaatatcaagaacaatattaccccgattac
tgtagtggaacagcttttgtaatttcccaggatgttgttcggaagatatatgttgttgcc
aaggaaacaatacttttggttcctcctgatgtctttgttggaatctgtgctaagaatgct
ggcatcatacccattcagagttctagattttctgggaaaaagcacattagatacaatcga
tgttgctacaaattcattttcacttcttccggaatggaagatgatgagatacttaaagaa
tggagggagataagtgatggaaaagactgcactttactggaaacttattatgggttggtg
tcctgcagagtcttgacctactttgacaagtttaaacattttaacatagaaacaataaaa
aatgaggctttccgttttaccaattaa

DBGET integrated database retrieval system