KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102456466Help
Entry
102456466         CDS       T02980                                 

Gene name
CDC23
Definition
(RefSeq) cell division cycle 23
  KO
K03355  
anaphase-promoting complex subunit 8
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
Module
APC/C complex
Brite
KEGG Orthology (KO) [BR:pss00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102456466 (CDC23)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    102456466 (CDC23)
   04114 Oocyte meiosis
    102456466 (CDC23)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    102456466 (CDC23)
Ubiquitin system [BR:pss04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     102456466 (CDC23)
Chromosome [BR:pss03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    102456466 (CDC23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 589 aa AA seqDB search
MGKMAAAAVVLGLGSCDFSDLREIKKQLLSVAERSRERGLQHSGKWASELAFALDPLPLS
ELPAVPALTEEDARDLDAYTLAKSYFDLKEYDRAAYFLRGCKSQKAYFLYMYSRYLSGEK
KKDDETVDSLGPLEKGQVKNEALRELRVELSKKHKAQELDGFGLYLYGVVLRKLDLVKEA
IDVFVEAVHVLPLHWGAWLELCNLITDKEMLKGLSLPDTWMKEFFLAHIYTELQLIEEAL
QKYQSLIDAGFSKSTYIISQIAVAYHNIRDIDKALSIFNELRKQDPYRIENMDTFSNLLY
VRSMKPELSYLAHNLCEIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKLNPRYLGAW
TLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLYYYRRAHQL
RPNDSRMLVALGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHEQLNESEQAAQ
CYIKYIQDIYSCGEIVEHLEVSTAFRYLAQYYFKCKLWDEASACAQKCCAFNDTREEGKA
LLRQILQLRNQGETSSTEIAAPFFLPASLSSNNTPTRRVSPLNLSSVTP
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagatggcggctgcagcggttgtgctcggtttgggaagctgcgatttttctgac
ctgcgagagatcaagaagcagcttctgagcgtagcggagcggagccgcgagcggggcctg
cagcatagcgggaaatgggcctccgaattggcatttgccctggatcctctgcctctgagc
gagctgcctgcagttcctgcgctcacagaggaggatgctcgtgatttggatgcctacaca
ttagctaaatcttacttcgatctgaaggagtatgacagggctgcatactttctgcgggga
tgcaagagtcagaaggcctacttcttgtatatgtattccagatacctgtcaggagaaaag
aagaaagatgatgaaaccgttgatagtctgggccccttggagaaaggacaggtgaagaat
gaagcactaagagagttaagggtggagcttagcaagaaacacaaagcacaggagctggat
ggttttggcctttatctgtatggtgttgtgctgcggaagctggacctggtaaaagaggcc
attgatgtgtttgttgaagctgtccatgttttgcctttgcactggggagcctggctggaa
ctctgtaatctgatcacagacaaagagatgctgaagggtctgtccttgccagacacgtgg
atgaaggagtttttcctggcacacatttacacagagttgcagctgatagaagaagctctg
cagaaataccagagtctcattgatgcgggtttttccaagagcacatacataatttcccag
attgcagttgcctaccataatatcagagacatagacaaagctctctctatcttcaatgaa
ctaaggaaacaagacccatacaggatagaaaacatggacaccttctccaacctgctgtat
gttcggagcatgaagcctgagctgagttacctggctcacaatctgtgtgagattgacaag
tatcgtgtggagacgtgctgtgtgatagggaattactatagtctgcgctctcagcatgaa
aaagcagcactctatttccagagagccttgaaattgaaccctcggtatcttggagcctgg
accctcatgggacatgagtacatggaaatgaagaacacatctgcagctatccaagcttat
agacatgcaatagaggtgaacaagagggactacagagcctggtatggacttgggcaaact
tatgagatcctcaagatgccattttactgtctgtattattaccgacgggcccaccagctc
aggcccaacgattcccgtatgctggttgctctgggagagtgttatgagaaactcaatcag
ctggtagaagctaaaaagtgttattggagagcttatgcggtgggggatgtggagaaaatg
gcactggtgaaactagccaagctgcatgaacagctgaatgaatcagaacaggctgctcag
tgctacatcaaatatatccaggatatctattcctgtggggagatagtggagcacctggag
gtgagcactgccttccgctacctagcccaatattacttcaagtgtaagctctgggatgaa
gcctcggcctgtgctcagaaatgctgtgcattcaatgatacaagagaagaagggaaggcc
ttgctgcgacagattttacagctacgcaaccaaggagaaacctcctccacagagattgct
gctcccttcttcctccctgcatcgctgtcatccaacaacacgcccacacggagagtgtcc
ccactcaacctgtcttcagttactccatga

DBGET integrated database retrieval system