KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102464028Help
Entry
102464028         CDS       T02980                                 

Gene name
NSD2, WHSC1
Definition
(RefSeq) nuclear receptor binding SET domain protein 2
  KO
K11424  
histone-lysine N-methyltransferase NSD2 [EC:2.1.1.43]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:pss00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    102464028 (NSD2)
Enzymes [BR:pss01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102464028 (NSD2)
Chromosome [BR:pss03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102464028 (NSD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
LinkDB All DBs
Position
Un
AA seq 1406 aa AA seqDB search
MDFSVKRSSPLLTRKINHIKMKQVPEILGNANAKTQNCEVNRECSVYLGKAQLSATLQEG
VMQKYNGHDGLPFIPADKLKDLTSRVFNGESGAQDTKLRFEPQEIKGVGTPPNTTPIKNG
SPEIKLKITKTYMNGKPLFESSICGDSGAAVSQSEENEQKTANKERRNRKRSIKYDSLLE
QGLVESALVSKTSSPSEKKVYTRQRNPVYLMPFKQTPAKKDSSATTVKEDKVHVLKYNVG
DLVWSKVSGYPWWPCMVSADPLLHSYTKLKGQKKSFRQYHVQFFGDAPERAWIFEKSLVS
FKGEEQFEQLCQESAKQALTKAEKIKMLKPVSGKLRPQWEMGIKQASEALGMAVEERKAK
FTFIYIRDRPHLNPRVAKEAGIAVEPLEEIDESSYSNQETTQSLKLMKESGIPSKRRRRT
SKLPSTDTKESDQLGTKTTTLQKAYEQGETKRGTGSPINRKKAAASTPRSRKGDAVSQFL
VFCQKHRDEVVAEHPDASSEEIEELLESQWNMLSEKQKARYNTKFAIVTSPKSEEDSGSS
LKNIGEAKRKVFQDSPKRRSRSRSNLHGNKRNQKKRTKEPSEDFEVQEAPRKRLRMDKQN
NRKRETSNDKTAKTKVTETFSSQKNQSATKNLSDACKPLKKRNRASAAESSTLAFSKSSS
PSASLTENEISDGQGDERSESPYESADETQTEASISSKKSERGAAAKKEYVCQLCEKPGD
LLLCEGLCFGAFHVSCLGLPGRPAGKFICRECTSGVHTCFVCKERKAEVKRCIVSQCGKF
YHEACVRKFHLTVFENRGFRCPLHSCVSCHVTNPSNPRISKGKMMRCIRCPVAYHAGDVC
IAAGCAVITSNSIVCTNHFTAMKGKSHHAHVNVSWCFVCSKGGSLLCCESCPAAFHPDCL
NIEMPDGSWYCNDCRAGKKLRFQDIIWVKLGNYRWWPAEVCHPKNVPPNIQKMKHEIGEF
PVFFFGSKDYYWTHQARVFPYMEGDRGSRYQGIKGIGKVFKTALQEAEARFREIKLQREA
KETQENERKPPPYKHIKVNKPCGKVQIYTADISEIPKCNCKPSDENPCGFDSECLNRMLM
YECHPQVCPAGERCQNQCFTKRQYPETKIIKTDGKGWGLVAKRDIKKGEFVNEYVGELID
EEECRARIKHAHENDITHFYMLTIDKDRIIDAGPKGNYSRFMNHSCQPNCETLKWTVNGD
TRVGLFAVCDIPAGTELTFNYNLDCLGNEKTVCKCGAPNCSGFLGDRPKNSSANSSEEKG
KKTKKRTRRRKTKNEGKKESEDECFRCGDGGQLVLCDRKSCTKAYHLSCLDLVKRPFGKW
ECPWHHCDVCGKPSVSFCHFCPNSFCKEHEDGTVLNSTLDGQLCCSEHVLGVDSVENQKT
EKPPKKLTKLKPKKKRRNRWMRAECK
NT seq 4221 nt NT seq  +upstreamnt  +downstreamnt
atggactttagcgtcaaaagaagttctcctctgttaacgcgaaaaattaaccacatcaaa
atgaaacaggtaccagagatccttggaaatgccaatgcgaaaacacagaattgtgaagtg
aatcgtgagtgttctgtctacttaggcaaagcacagctttctgccactctacaggagggt
gtcatgcaaaaatataatggccacgatggtcttccgtttattccagctgataaattgaaa
gatctaacttctcgtgtgtttaatggcgagtctggggcacaagatactaagctgcgcttc
gagccccaggaaataaaaggagttggaacaccacctaacactactcctatcaagaatggc
tctccggagataaagctgaaaatcactaaaacctacatgaacggaaagcctctctttgaa
tcttccatttgtggagacagtggagcagctgtgtcccagtcagaggaaaatgaacaaaaa
acagcaaacaaggagagaagaaacagaaaaagaagcataaaatacgactccttacttgag
cagggtcttgttgaatcagcgttagtgtcaaagacttcaagcccctctgaaaagaaggta
tacaccaggcaacggaatcctgtgtatctgatgccttttaagcagactcctgctaagaaa
gattcttctgcaactactgtaaaagaagacaaagttcatgtgttgaagtacaatgtaggg
gatctggtgtggtctaaagtgtctggttatccttggtggccgtgcatggtttcagctgat
cctcttcttcattcctacactaaactaaaaggacagaaaaagagttttcgtcagtatcat
gtacagttttttggtgatgctccagaacgagcttggatatttgagaagagccttgtgtca
tttaaaggagaagaacagtttgaacaattatgccaggaaagtgcaaaacaagccctcact
aaagctgagaaaataaagatgttaaagcctgtttctggaaaactgcggcctcagtgggag
atgggcattaagcaagccagcgaagcactaggcatggcagtggaagaacggaaagccaag
ttcacttttatctacattagggacagacctcatcttaatcctcgagtggcaaaggaggct
ggtattgctgtggaaccattagaggaaatagatgagtcctcttactcgaaccaagaaacc
actcaaagtctgaaattgatgaaggaatctggcattcctagcaagaggaggaggaggaca
tcaaaactgccttcaactgatacaaaagaaagtgatcagttagggactaagactactacc
ctacaaaaggcatatgaacaaggagaaaccaaaagagggacaggttctcccatcaataga
aagaaagctgcagcatctactccacgaagcagaaagggtgatgcggtatctcagtttttg
gtcttttgtcagaagcacagagatgaggtggttgctgaacatccagatgcttcaagtgag
gagattgaagaactgcttgaatcgcagtggaacatgcttagtgaaaaacagaaagctcgc
tataacacaaagtttgccatagtgacctctcccaaatctgaagaagactctggttcatca
ttgaagaatattggagaggccaaacgtaaagtgtttcaagactcacctaaaaggagatca
agatccagaagtaacttacatggaaataaaagaaaccaaaaaaagaggacaaaggaacct
tcagaagattttgaagttcaggaagcacctaggaaaagactcaggatggataaacagaat
aatcggaagagggagacaagcaatgacaaaacagcaaaaacaaaggtcacagaaaccttc
tcttcacaaaagaaccagtcagcaacgaaaaatctgtctgatgcatgtaaaccactgaag
aagcgaaatcgggcttcagcagcagaatcttcaactcttgcttttagcaagagttcatct
ccttcagcttccttaactgaaaatgagatctcggatggtcaaggagatgagcgatcagag
tcaccctatgaaagtgcagatgagactcagacagaagcttctatatcatccaaaaaatct
gagagaggagcagcagcaaaaaaagaatatgtgtgtcagctgtgtgaaaaacctggtgat
ctcctgctatgtgaaggcctatgctttggagcttttcatgtaagctgccttgggctccct
ggaagaccagcaggaaaattcatttgtcgtgaatgtacatcaggtgtccatacttgtttt
gtgtgtaaggagagaaaggcagaagtgaaacgctgtattgtatcccagtgtggtaaattc
taccatgaagcttgtgtgagaaaatttcatcttactgtgtttgagaacagaggttttcga
tgtcctctccatagctgtgtgagctgccatgttactaacccctcaaatccaagaatatca
aaaggcaaaatgatgcggtgtattcgttgtcctgtggcttaccatgctggagatgtctgc
attgctgcagggtgtgcagtgatcacttccaatagcattgtttgtaccaatcatttcact
gctatgaaaggaaaaagtcatcatgcacacgtcaatgtgagctggtgctttgtgtgctca
aaaggaggaagtctgttgtgctgtgagtcatgtcctgcagcatttcacccagactgttta
aatattgaaatgccagatggtagctggtattgcaatgactgtagggcaggaaagaaactc
cgcttccaggatatcatttgggtcaaactgggaaattacagatggtggcctgcagaagtt
tgccatccaaaaaatgttcctccaaatatccagaaaatgaagcatgaaattggagaattt
ccggtgtttttctttggttctaaagattattactggacacatcaagctcgtgtgtttcca
tatatggaaggagacagaggaagtagataccaaggaattaaaggaattggaaaagtcttc
aaaactgccttgcaagaagcggaagctcgatttcgagaaataaaacttcagcgagaagcc
aaagaaacccaagagaatgaacgtaaacctccaccatacaaacacataaaggtgaacaaa
ccttgtggtaaagttcagatttatactgctgacatttctgagattcccaagtgcaactgc
aaaccttctgatgagaacccttgtggttttgattctgagtgtctaaaccggatgctaatg
tatgaatgtcatccacaagtttgtccagctggagaacgctgccaaaatcagtgctttacc
aaacgccaataccctgagacaaagatcatcaaaactgatggcaaagggtggggtctggtt
gctaagagggacataaaaaagggagaatttgtgaatgaatatgttggtgaactaattgat
gaagaggaatgtagggcaagaatcaaacatgcacatgaaaatgatatcactcacttctat
atgctcactattgataaggaccgtattattgatgctggccccaaaggaaactattctcgt
tttatgaatcacagctgccaaccaaattgtgagactctcaaatggacagtgaatggagat
acccgtgtaggcctgtttgctgtgtgtgatatccctgcaggaacagagctgacttttaac
tacaaccttgactgtcttggcaatgaaaaaactgtctgtaaatgtggcgccccaaactgt
agtggatttcttggggatagaccaaagaattcttccgctaattcttcagaggaaaaaggc
aaaaagaccaaaaaaagaactcggagacgtaaaacaaaaaatgagggaaagaaagagtct
gaagatgagtgtttccgttgtggggatggaggtcaacttgtattgtgtgacaggaaatct
tgtactaaggcataccatctctcctgtcttgacttggtgaaacgtccttttggaaaatgg
gagtgtccttggcaccactgtgatgtttgtggcaagccttctgtttctttttgccacttc
tgcccaaattctttctgcaaggaacacgaagatgggacagtactaaattctacattagat
ggacagttatgctgctctgaacatgttcttggggtagattctgttgaaaatcagaagact
gagaaacccccaaaaaaattgaccaagttgaagcctaaaaaaaagcgaaggaacagatgg
atgagagctgaatgcaaataa

DBGET integrated database retrieval system