KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_2135Help
Entry
PSPTO_2135        CDS       T00118                                 

Gene name
pvsA
Definition
(RefSeq) pyoverdine chromophore precursor synthetase
Organism
pst  Pseudomonas syringae pv. tomato DC3000
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2307860..2320870
Genome map
AA seq 4336 aa AA seqDB search
MDAFELPDTLAQALQRRASQTPDRLALRFLTDEKTQGLVLTYRDLDLRARTIAAALQSQA
APGDRAILLFHSGPDYVAAFFGCLYAGVIAVPAYPPESNRRHHQERLLSIIADAEPRLVL
TASDVQPALLQMEELAAAGAPPLLCVDTLDSALADGWQGPQLQADHIAFLQYTSGSTALP
KGVQVSHGNLVANELLIRHGFGIDVNPDDVIVSWLPLYHDMGLIGGLLQPIFSGVPCILM
APAYFLTRPLRWLEAISEYGGTISGGPDFAYQLCSARVSDSALERLDLSRWRVAYSGSEP
IREDSLNAFAEKFASCGFTPDSFMASYGLAEATLYVAGGKRGKGIPSLRLDTQALARNVA
EPGDGQPVMSCGTGQPGHGVLIADPVTLHVLAENSIGEVWASGPSIAHGYWRNPEASAKT
FVQHDGQTWLRTGDLGFQRHGELYITGRLKDMLIVRGHNLYPQDIEKVIEREVDVVRKGR
IAAFAVNQDGSEGIGIAAEISRSVQKILPPEALIKLIRQTVAEAFQEAPSVVVLLNPGAL
PKTSSGKLQRSACRIRLADGSLDSYAVFPASGTTIQNHTSSTGSELQAQIASVWCEQLQC
EQVSADDHFFLLGGNSIVATQVVARLRETLGIDLNLRLLFEAPTLSAFAAQIEALQIAAS
QGNSQAQNAIVRLPGNEHLPQSLAQNRLWFLWQLDPQSSAYNIPGGLHLRGELDINALRS
SFQRLIERHESLRTRFYEQDGVALQRIDAAGEFQLHSIDISELPGEERQARARAIREEQA
RLPFDLQNGPLLRVTLLQLDEEEHQLLVTLHHIIADGWSLNVLIDEFSRLYASAVQGQTL
ELTPLPLRYADYGQWQREWLAQGEAERQLDYWKQQLGDEQPTLTLSTDHSRSLRKQHSAS
RYSLRLSAELSAALSNTAQAWQSTPFMLLLAGFQTLLHRYSGQTDIRIGVPGANRPRHET
QGLIGFFINTLVLRAQLDPRLPFSTLLSQTRQAALDAQAHQDVPFEQLVEAFPQAREHGL
FQVMFNHQQRDLSALRRLPGLLAEELPWHSREAKFDLQLHSEEDRNGRLNLSFDYADELF
ERDTIVRLARHYVQLLTQVSQQAQVALGDLQLLNADELAEQAQWSAAACTPAQNWLPELL
ERQALQTPERIALVWEGGSLDFASLHAQANRLAHYLRDKGVGPDIKVAIAAERSPQLLIG
LLAILKAGGAYVPLDPDYPTDRLAYMLQDSGVELLLTQSHLLGDLPSAEGVCTLAMDMLH
LDNWPVSAPGLHLHGDNLAYVIYTSGSTGQPKGVGNTHAALAERLQWMQATYALDETDVL
MQKAPISFDVSVWECFWPLITGSRLLLAGPGEHRDPHRIAQLVNEYGVTTLHFVPPLLQL
FIDEPLTQQCSSLRRLFSGGEALPSELRNRVLEQLPNVQLHNRYGPTETAINVTHWQCLR
ADGLRSPIGRPLGNVLCRVLDSELNPLPRGVAGELCIGGIGLARGYLNRPGLTAERFIAD
PLGQPGERLYRTGDLVRWATDGALEYLGRLDQQVKLRGFRVEPQEIEARLLAQPGVGHAA
VLVRETAAGPQLIGYYTAEAGQEVQAEHIKSALALELPDYMVPAQLVRLDSMPLSPSGKL
DRRALPEPQWQTREHVEPHTDLQKQIAAVWRQVLGVPRVGLRDDFFELGGHSLLATQIIS
RVRQACDIDLPLRALFEASELGAFAEQVQTLQQSGARNSLQPIARVDRSQPVPLSYSQQR
MWFLWQMEPDSPAYNVGGMARLNGVFDIECFEAALQALILRHETLRTTFPSVNGVACQKV
SGQTGLSVQWQDYYALPTEVRQQCIQALADSEAHQPFDLETGPLLRACLVRAAELEHYFV
LTLHHIVTEGWAMDIFARELGLLYEAFLDGKPSPLEPLAVQYLDYSVWQRQWMEAGERQR
QLDYWTAQLGNEHPLLELPCDRPRPPVQSHQGELYRFDLDPELAAKVRAFNARNGLTLFM
TMTATLAVLLYRYSGQNDLRIGAPVANRIRPESEGLIGAFLNTQVLRVQLDGQMSVAQLF
EQVRHTVIEGQSHQDLPFDHLVEALQPPRSAAYNPLFQVMCNVQRWEFQQSRDLAGMTVD
YLVNDARATKFDLNLEVTELDHRLGCCLTYSTDLFDEPRIAQMAEHWLNLLQALLVNPQQ
RLSELPLLQNAERQQLLDSLGVEAGEQRLDQCIHSLFAEQARLRPQAAALTFAGETLSYA
ELNARANQLAGMLRQRGVGPQVRVGLALPRSLDMVVGLLAILKAGGAYVPLDPEYPLERL
HYMIEDSGVGLLLSDRALFAALGELPAGVAHWCLEDDQPLLEAFSSDELPFISLPQHQAY
LIYTSGSTGKPKGVVVSHGEIAMHCQAVMRRFDMQPDDCELHFYSINFDAATERLLVPLL
SGARVVLRAQGQWDAEEICTLIREQQVNILGFTPSYGSQLAQWLAIQGQTLPVRMCITGG
EALTGEHLQRIRAVFQPELFFNAYGPTETVVMPLASLAPQQLEEGEASVPIGRIVGARVA
YILDADLALVPQGASGELYIGGAGLAQGYHQRPGMTAERFVADPFASNGGRLYRTGDLVR
QRTDGLVEYLGRIDHQVKIRGFRIELGEIESRLLEHESIREAVVLALDTPSGKQLAGYLV
SEMAGQGDEQQAQLRESLKAHLKAQLPDYMVPTHLMLLASMPLTANGKLDRRALPAPGPE
LNRQHYIAPASELEQQLAAIWCAVLNVEKVGLNDNFFELGGDSILSIQVVSRARQAGIHF
SPRDLFQHQTVQTLAAVATTRELIQAEQGLLEGASALTPIQHWFFDTPIPQRQHWNQSLV
LEPVSALDPRILEQALRAVLEQHDALRLSFTEQNGKWQAEHRAVTAETLLIQARVADMAE
CAALYADTQRSLDLQNGPLLRALLVDGAQGQQRLLMVIHHLVVDGVSWRVLLDDLQTAYR
QLSDVTPVRFAAKTSAFRDWAARLQAYAGNESLREELHVWQRQLGGPATNLPCHNSQGGQ
QNRHAQTVSVRLDAERTRQLLQQAPSAYRTQVNDLLLTALAQVVCRWSGQPSALIQLEGH
GRETLFDDIDLTRTVGWFTSAYPLRLTPALAADAAPGDSIKAIKEQLRQVPHKGLGYGML
RYLADAASKAAMQALPVAPITFNYLGQFDQSFADDALFRPLEESAGAAHDPHAPLPNELS
IDSQVYGGELLLRWTFSAERYQPAAIEALAQAYLNQLQALIAHCLSDGSGGLTPSDFPLA
DLDQTQLDALPVPATHIEDVYPLTPMQEGMLLHTLLEPGTGLYYMQDRYRINSALDPERF
AQAWQAVIARHEALRASFCWDIGETMLQVIHKPGSTPIDYLDWRDVLADEQEPRLQALLK
SEREAGFDLLNQPPFHLRLIRVDEARYWFMMSNHHILIDAWCRSLLMNDFFDIYTALGEG
REAQLTPAPRYRDYIGWLQRRGLVQARDWWQHNLRGFERPTPIPSDRPFLREHAGDSGGM
VVGDCYTRLDERDGAQLRELAQQHQLTVNTFAQAAWALTLRRMSGDRDVVFGVTVAGRPV
ELPQMQRTVGLFINTIALRVGMPGDEQRCTVRDWLSQLLDSNMQLREYEYLPLVTIQENS
ELPKGQPLFDSLFVFENAPVEVSVLDRAQSLNATSDSGRTHTNYPLTAVCYPGDDLGLHL
SYDQRYFDESTVQSMLDEFKRLLLALIEGFHGDMAGLALVSEQERTFLIEGCNQSDHAYP
LDKSYVELFEAQVEAHPERIAVSCLDRQLGYAELNIASNRLGHALIEAGVGFDQPVALLA
ERGPELLGMIIGSFKAGAGYLPLDPALPNVRLSGIIAQSRTPVLVCSAQCLDQGRALLEV
LPESHRPQLRVWEDVQQSESAQHNPGRYSAADNLAYVIFTSGSTGLPKGVMVEQRGMLNN
QLSKVPYLNLRDSDVIAQTASQSFDISVWQFLAAPLFGARVDIVPNDIARDPQALLAHVQ
AQRISVLESVPSLITGLLAEQHATLDSLRWLLPTGEAMPPELASQWLQRYPAIGLVNAYG
PAECSDDVAFFRVDADSTRSAYLPIGSPTDNNRLYLLDDALDLVPLGAVGELCVAGAGVG
RGYVADPSRTVPVFVPHPFGAPGERLYRTGDLARRRKDGVLEYVGRVDHQVKIRGYRIEL
GEIETRLLEHPAIRESVVLDIDGPLGKVLAAYLVPSAATQDHDALRDALKSHLKASLPDY
MVPAHLVILDAMPLTPNGKLDRKALPAPDVSQAQQEYLAPQTEMEQQLATIWADVLKVER
VGITDNFFELGGHSLLATQVVTRAQKLLQRNVPLRAMFEFNTVQALAEHLESLGGAQVDE
QKFDRLADLMAELEGF
NT seq 13011 nt NT seq  +upstreamnt  +downstreamnt
atggatgcgtttgaactccccgacaccctggctcaggcccttcagcgtcgcgcctcgcag
acgccggatcggctggccctgcgttttctcaccgacgagaaaacccaagggctggtgttg
acctaccgtgatctggacctgcgcgcacgcaccatcgccgccgcgctgcaaagccaggct
gcgccgggcgatcgggcgattctgctgttccacagcgggccggattatgtcgctgcgttt
ttcggctgcctgtacgccggtgtgatcgcggtgccggcttacccgccggaatccaaccgc
cgtcatcatcaggagcggctgctgtcgatcattgctgatgccgagccacgtctggtgctg
accgcttccgacgtgcagcctgccttgttgcagatggaagaactggccgctgccggtgcg
ccgccactgctgtgtgtcgatacgctggacagcgctttggccgatggctggcaggggccg
cagttgcaagccgaccacatcgcgtttctgcaatacacctcgggctcgacggccttgccc
aaaggcgtgcaggtcagtcatggcaatctggtcgccaacgagctgttgattcggcatggc
tttggcatcgacgtcaacccggacgacgtgatcgtcagctggctgccgctgtatcacgac
atgggcctgatcggcggcttgttgcaaccgattttcagcggcgtgccgtgcatcctcatg
gccccggcctatttcctcacgcggccgttacgctggctggaggcgatcagtgaatacggt
ggcaccatcagcggcgggcctgattttgcctaccaactgtgcagcgcacgggtcagcgat
tcggcgctggagcggctggacctgagtcgctggcgcgtggcgtattccggctccgagccg
atccgcgaagacagcctgaatgcgttcgccgagaaatttgccagttgtggcttcacgccg
gacagcttcatggcgtcctacggcctggccgaagccacgctgtatgtggccggcggcaag
cgcggcaagggcattccttcgttgcgtctggatacgcaggcgctggcgcgcaacgtggcc
gaaccgggcgacggtcaaccggtcatgagctgcggcaccggccagccggggcacggcgtg
ttgattgccgaccctgtcaccctgcacgtgctggctgaaaacagcattggcgaagtctgg
gccagtgggccgagcatcgcccacggttactggcgcaaccctgaagccagcgccaaaacc
ttcgtccagcatgacggccagacctggctgcgcaccggcgatctgggctttcagcgccac
ggcgagctgtacatcaccggccgtttgaaagacatgctcatcgtgcgcgggcacaacctg
tacccgcaagacatcgagaaagtgatcgagcgcgaagtcgatgtggtgcgcaaaggtcgc
attgcagcatttgccgtcaatcaggacggcagtgaaggcatcggcattgccgctgaaatc
agccgcagcgtgcagaaaatcctgccgcccgaagcgctgatcaaactcatccggcagacc
gtggccgaagcctttcaggaagcgccgagcgttgtcgtgctgctcaatccgggggcgttg
cccaagacttccagcggcaaattgcagcgttcggcctgccgcatccgactggccgatggc
agcctcgacagctatgccgtatttcctgcatccggtacaaccattcaaaaccacacttca
agcaccggctcggaactgcaagcgcagatcgccagcgtctggtgcgagcagttgcagtgc
gaacaggtcagcgccgacgatcattttttcctgctcggcggcaactcgattgtggcgacc
caggtggtggccaggttgcgcgagacgctgggcatcgacctgaacctgcggctgctgttt
gaagcgccaacgctgtcagcctttgctgcgcagatagaagcgcttcagatcgctgcatcg
caaggcaacagtcaggcgcagaacgctatcgttcgcctgccgggcaacgagcatctgccg
caatcgctggcgcagaaccgtttgtggttcctttggcagcttgatccgcaaagcagcgcc
tacaacattcctggtgggctgcacctgcgtggcgagctggatatcaatgcattgcgcagc
agcttccagcgcctgattgaacggcatgaatcactgcgtacgcggttttacgaacaggac
ggtgtggccctgcaacgcatcgacgcagcgggcgaattccagttgcacagcatcgacatc
agcgagctgcccggcgaggagcgccaggcgcgtgcgcgtgcgatccgtgaagagcaggcg
cgtctgccgttcgatctgcaaaacggcccgttgctgcgcgttacgctgctgcaactggac
gaagaagagcatcagttgctggtcacgctgcaccacatcattgctgatggctggtcgctg
aatgtgctgatcgacgagttctcgcgcctctatgcatcggctgttcaaggtcagaccctg
gaactgacgcctttgccgctgcgctacgccgactacggccaatggcagcgtgaatggctg
gcgcaaggcgaggccgagcgtcagctcgactactggaagcagcaactgggtgatgagcag
ccaaccctgacgctgagcaccgatcactcgcgttcgctgcgcaagcagcacagcgcttcg
cgttacagcctgcgcctgagcgccgaactgagcgcggcgctgagcaatacggcgcaggcc
tggcaatcgacaccgttcatgctcttgctggccggcttccagaccctgttgcatcgctac
agcgggcagaccgatattcgcatcggcgtgcccggtgccaaccgcccgcgccatgaaact
cagggcctgatcggcttcttcatcaacaccctggtgctgcgtgcgcaactggacccacgc
ctgccgttttcgaccctgctgagccagacccgccaagccgcactcgacgcccaagcgcat
caggacgtgccgttcgagcaactggtcgaagccttcccgcaggcgcgtgagcatggtttg
tttcaggtcatgttcaaccaccagcaacgcgacctcagcgccttgcgccggctgccgggg
ctgcttgccgaagagctgccgtggcacagccgcgaggccaagttcgacctgcaactgcac
agcgaagaggaccgtaacggtcgcctcaacctgtccttcgactacgccgacgagttgttc
gagcgcgacactatcgtgcgtctggcccggcactatgttcagttactgacccaggtcagc
cagcaggcacaggtcgcgctgggcgacctgcaattactcaacgctgacgagctggccgaa
caggcgcaatggagcgccgcggcctgcacgcctgcgcaaaactggttgcctgaattgctg
gagcgtcaggcgctgcaaacccctgagcgtattgcgctggtgtgggagggcggcagcctc
gatttcgccagcctgcatgcccaggccaatcgtctggcgcattacctgcgtgacaaaggc
gtcggcccggacatcaaggtggcgattgccgccgagcgttcgccacagctgttgatcggt
ctgttggcgatcctcaaggccggtggcgcttacgtgccgctggacccggattacccgacg
gatcgactggcctacatgctgcaggacagcggcgtcgaactgctgctgacccagagccat
ctgctcggcgacctgccgagtgccgagggcgtttgcacgctggcgatggacatgctgcac
ctggacaactggccggtcagcgcgccgggcctgcacctgcacggcgacaatctggcctac
gtgatttacacctcgggttccaccggtcagcccaaaggcgtcggcaacacccacgcggcc
ctggccgagcgcctgcaatggatgcaggccacgtacgcgctggacgaaaccgacgtgctg
atgcaaaaggcaccgatcagcttcgacgtgtcggtgtgggaatgtttctggccgctgatc
accggcagccgcctgctgctggcaggccccggcgaacaccgcgacccgcaccgaatcgcg
caactggtcaacgaatatggcgtgaccacgctgcatttcgtgccgcctctgctgcaactg
ttcatcgacgaaccgctgacgcagcagtgcagtagcctgcgtcgcctgttctccggcggc
gaagcgctgccgagtgaactgcgcaaccgggtgctggagcaactgccgaacgtgcagttg
cacaaccgttatggcccgaccgaaaccgcgatcaacgtcactcattggcagtgcctgcgt
gccgatggcctgcgttcgcccatcggtcgtccgctgggtaacgtgctgtgccgggtgctg
gacagcgagctgaacccgctgccacgcggggtggccggtgagctgtgcatcggtggcatc
ggcctggcgcgtggttatctgaaccgtccgggcctgactgccgaacgctttatcgccgat
ccgctgggccagccgggcgaacgcctgtaccgcacgggtgaccttgtgcgctgggcgact
gatggcgcgctggaatatctggggcgtctcgatcagcaggtcaaactgcgcggtttccgc
gtcgaaccgcaggaaatcgaagcccgcctgttggctcaaccgggcgttggtcacgccgcc
gtgctggtgcgcgaaaccgccgctggcccgcaactgatcggttattacaccgccgaagcc
gggcaggaagttcaggccgagcacatcaaatcggccctggcgctggaactgccggactac
atggtcccggcgcaactggtgcgcctcgacagcatgccgctgagcccgagcggcaagctg
gatcgccgcgccttgcccgagccgcaatggcaaacccgcgaacatgtcgagccgcacacc
gacctgcaaaagcagatcgccgctgtctggcgacaagtgctgggcgtgccgcgtgtcggc
ctgcgcgatgactttttcgagctgggcgggcactcgttgctggccacgcagatcatttcc
cgtgtgcgtcaggcttgcgacatcgacctgccgttgcgggcgctgttcgaggccagcgag
ctgggcgcattcgctgaacaggttcaaacccttcagcagtctggcgcacgcaacagcctg
caacctattgcccgcgtcgatcgcagccagccggtgccgctgtcctattcgcaacaacgc
atgtggttcctctggcagatggaaccggacagcccggcgtacaacgtcggcggcatggcg
cgcttgaacggtgtgttcgatatcgagtgtttcgaggccgcgctgcaagccttgatcctg
cgccacgaaaccctgcgtactaccttcccgagcgtcaacggcgtggcctgccagaaagtt
tccgggcagaccggcctgagcgtgcagtggcaggactactatgcgctgcctaccgaggtt
cgtcagcagtgcattcaggcgctggccgacagcgaggcgcatcaacccttcgatctggaa
accgggccgttgctgcgtgcctgtctggtcagggcggcggagcttgaacattacttcgtc
ctgaccctgcaccacatcgtcaccgaaggctgggcgatggatatcttcgcccgcgaactg
ggcctgctttacgaagcgtttctggacggcaagccgtcgccgctggagccgctggcggtg
cagtacctcgattacagcgtctggcagcgtcagtggatggaagccggcgagcgtcagcgc
caactggattactggaccgcgcaactgggcaacgagcatccgctgctggaactgccttgc
gaccggccgcgtccgcccgtgcaaagccatcagggcgagctgtaccgcttcgatctggac
cccgagctggccgccaaagtccgcgctttcaatgcccgcaacggtttgaccctgttcatg
accatgaccgccacgctggcggtgctgctctaccgttacagcggccagaatgacctgcgc
atcggtgcaccggtggccaaccgcattcgtccggaaagcgaagggttgatcggcgcgttc
ctcaacacccaggtgctgcgcgtgcagctcgacgggcagatgagcgtcgcgcagttattt
gaacaggtgcgccacacggtaattgaaggtcagtcgcatcaggacttgccgttcgatcat
ctggtcgaagccctgcaaccgccacgcagcgcggcctacaacccgctgttccaggtgatg
tgcaacgtgcagcgctgggaattccagcaaagccgcgatctggcgggcatgactgtcgac
tacctggtcaacgatgcgcgggctaccaaattcgacctcaacctggaagtcaccgagctg
gatcaccgcctgggttgctgcctgacctacagcaccgatctgttcgacgaaccgcgcatc
gcgcagatggccgaacattggctgaacctgctgcaagcgttgctcgtcaatccgcagcag
cgtttgagtgagctgccgctgttgcagaacgccgagcgccagcagttgctcgacagcctc
ggtgttgaagcgggcgagcagcgtctcgatcagtgcattcacagcctgtttgccgaacag
gcccgattgcgcccacaggcggcggcgctgacctttgccggcgaaaccctgagttacgcc
gagctgaacgcccgtgccaaccaactggctggaatgctgcgccagcgcggcgtcggcccg
caggtgcgggttggtctggcgctgccgcgctcgctggacatggttgtcggcctgctggca
atcctcaaggccggtggcgcctacgtgccgctcgacccggaatacccgctggaacgcctg
cactacatgatcgaagacagcggcgtcggtctgttgttgagcgatcgagcgttgtttgcc
gcgttgggcgagttgcctgccggtgtggcccactggtgcctggaagacgatcagcctctg
ctggaggctttctcgtccgatgaactgccgtttatcagcctgccgcagcatcaggcgtac
ctgatttacacctccggttcgaccggcaagcccaagggcgtggtggtgtcccatggtgaa
atcgccatgcattgccaggcggtgatgcgtcgcttcgacatgcagccggacgactgcgaa
ctgcatttctattcgatcaacttcgatgccgccaccgagcgtctgttggtgccgttgctc
agcggcgcacgcgtggtattgcgcgcgcaaggccagtgggacgccgaagaaatctgcacg
ctgattcgtgagcagcaggtcaatattctcggtttcacccccagctatggcagccagttg
gcgcaatggctggcgatccagggtcagaccttgccggtgcgcatgtgcatcaccggcggc
gaagcgctgaccggcgaacacttgcagcgcattcgtgcagtctttcagccggaactgttc
ttcaacgcctatggcccgactgaaacggtagtcatgccgctggccagcctggcgccgcag
caactggaggaaggcgaagccagcgtaccgattggccgcatcgtcggggcgcgcgttgcc
tatattctcgacgccgatctggcgttggtgccgcagggcgccagtggtgagttgtacatc
ggcggtgccggtctggctcagggctatcatcagcgccccggcatgaccgccgagcgtttc
gtggctgatccgttcgccagcaatggcgggcgtctgtaccgcaccggcgacctggtgcgc
cagcgcactgacggtctggtggagtacctggggcgtatcgaccatcaagtgaagattcgt
ggtttccgcatcgaactgggcgaaatcgaaagccgattgcttgagcatgagtcgattcgc
gaagccgtggtgctggcgctggacacgccgtcgggcaagcaactggcaggctatctggtc
agtgagatggccggtcagggcgatgaacagcaggcgcaactgcgtgaatcgctgaaagcg
cacctcaaggcgcagttgccggattacatggtgccaacccacctgatgctgctcgccagc
atgccgctgaccgccaacggcaagctggatcgccgcgccttgcctgcaccgggcccggag
ctcaatcgtcagcattacatcgcgcccgccagcgagctggagcagcaactggcggcgatc
tggtgcgcggtgctgaacgtcgagaaagtcggcctcaacgacaacttcttcgagctgggc
ggtgattcgatcctgtcgattcaagtggttagccgcgcgcgtcaggcgggtattcatttc
agcccgcgtgatctgtttcagcatcagaccgtgcagaccctggccgctgtggcgaccacc
cgtgaactgattcaggccgaacaggggctgcttgaaggtgcgtccgcgctgacgccgatt
cagcactggttcttcgacacgccgatcccgcagcgccagcactggaatcagtcgctggtg
ctggagccggtcagcgcccttgatccacgtattctggagcaggcgttacgggccgtgctt
gaacagcacgacgccttgcgcctgagtttcaccgagcagaacggcaagtggcaggccgag
caccgcgccgtcaccgctgaaaccctgctgatccaggcgcgggttgccgacatggccgaa
tgtgcagccttgtacgccgatacccagcgcagcctcgacctgcaaaacggcccgctgctg
cgtgccttgctggttgacggggcgcagggccagcaacgcctgttgatggtcattcaccac
ctggtggttgatggcgtttcgtggcgtgtgctgctcgacgatttgcaaacggcttatcgc
cagttgagcgacgttacgccagtgcgtttcgccgccaagaccagtgcgttccgcgactgg
gccgcgcgcttgcaggcctatgcgggtaatgaatcgttacgtgaagagttgcatgtctgg
cagcgtcaactgggcggtcctgcgaccaatctgccgtgccataactcgcagggcggccag
cagaatcgtcacgcgcaaacggtcagcgtgcggctggatgccgaacgtacccggcaactg
ctgcaacaggcccccagcgcctaccgcactcaggtcaacgaccttctgctgacggcactg
gcgcaagtggtctgccgttggagcgggcagccatcggccctgatccagctggaagggcac
ggtcgcgaaaccctgtttgacgacatcgacctgacccgcaccgtgggctggttcaccagc
gcctatccgctgcgcctcacgccagcactggctgccgacgcagcgccgggcgactcgatc
aaggcgatcaaggagcaactgcgccaggtgccgcacaaaggccttggctatggcatgctg
cgctatctggccgacgctgccagcaaggccgccatgcaggcgctgccagtggcgccgatc
accttcaattaccttggccagttcgaccagagcttcgccgacgatgcgctgttccgtccg
ctggaagagtcggcgggcgcggcccacgatccgcacgcgccgctgcccaacgagctgagc
atcgacagccaagtgtatggcggcgaactgctgctgcgctggaccttcagcgccgagcgt
tatcagcccgcggccatcgaagcgttggcgcaggcttatctgaatcagttgcaggcgctg
attgcccattgcctgagcgatggcagcggtggtctgacgccttcggacttcccgctggcc
gatctggatcagacgcaactcgacgcgctgccggtccctgcgacgcacattgaggacgtc
tacccgctgacgccgatgcaggagggcatgctgctgcacaccctgctggaacccggcacc
ggcctgtattacatgcaggaccgctaccgcatcaacagcgcgctcgacccggagcgtttc
gcccaggcctggcaggcggtgattgcccgtcacgaagcgctgcgtgcctcgttctgctgg
gacattggcgaaaccatgctgcaggtcattcacaagccaggcagcacgccgattgattat
ctggactggcgtgatgtgcttgcggacgaacaggaaccgcgcttgcaggccttgctcaag
tccgagcgcgaggctggtttcgatctgctcaatcagccgccgttccacctgcgcctgatc
cgcgtcgatgaagcgcgctattggttcatgatgagcaaccaccacatcctcatcgatgcc
tggtgccgttcgctgctgatgaacgacttcttcgacatttacaccgcgttgggtgaaggg
cgtgaagcacaactgacgcctgcgccgcgctatcgcgattacatcggctggctgcaacgc
cgtggcctggtgcaggcgcgcgactggtggcagcacaacctgcgcggctttgaacggccg
acgccgatccccagcgaccgtccgttcctgcgtgaacatgccggtgacagcggcggcatg
gtggtgggcgattgttacacccgtcttgatgagcgcgacggcgcacaactgcgtgaactg
gcccagcagcatcaactgaccgtcaacacgttcgcccaggcggcgtgggccttgaccttg
cggcgcatgagcggtgatcgcgacgtcgtgttcggcgttaccgtggccgggcgaccggtg
gaattgccgcagatgcagcgcaccgtcggcctgttcatcaacaccatcgccctgcgcgtg
ggcatgccgggcgacgaacagcgctgcacggttcgtgactggctaagccagttgctggac
agcaacatgcaactgcgcgagtacgaatacctgccgctggtgaccattcaggaaaacagc
gagctgcccaagggccaaccgctgttcgacagcctgttcgtgtttgaaaacgcgccggtg
gaagtctcggtgctcgaccgtgcgcaaagcctcaatgccacctctgattccggccgcacc
cacactaactatccgctgacggccgtgtgctatccgggtgatgacctgggcctgcacctg
tcctacgaccagcgttatttcgacgaatccaccgtgcagagcatgctcgacgagttcaag
cgcctgctgctggcgctgatcgaaggtttccatggcgacatggccgggctggcgctggtc
agcgagcaggagcgcacgttcctgatcgagggctgcaaccagagcgatcacgcttacccg
ctggataagagctacgtcgaactgtttgaagcgcaggttgaagcgcatccagagcgtatt
gcggtcagttgtctggatcgccagcttggctacgccgagctgaatatcgccagcaatcga
ctgggccatgcgctgatcgaggccggggttggcttcgatcagccggtggctttgctggcc
gagcgcgggcctgaattgctcggcatgatcatcggcagcttcaaggccggtgccggttac
ctgccgctggacccggcgctgccgaatgtgcgattgagcggcatcatcgcccagagccgc
acgccggtgctggtgtgcagtgcgcaatgtctggatcagggcagggcgctgcttgaggtg
ctgcccgagtcccatcgtccgcagttgagggtctgggaagacgtgcagcagagcgaatca
gcgcagcacaatccgggtcgctacagcgcggcggataacctggcttacgtgattttcact
tccggctccaccgggctgccgaagggcgtgatggttgagcagcgcggcatgctcaataac
cagttgagcaaggtgccctacctgaacctgcgcgacagcgatgtgatcgcccagaccgct
tcgcaaagtttcgacatctcggtctggcagttcctcgccgcgccgctgtttggcgcgcgg
gtggacatcgtgccgaacgatatcgcccgcgacccgcaggccctgttggcgcatgtgcag
gcgcagcgcatcagcgtgctggaaagcgtgccgtcgctgattaccggcctgcttgccgaa
cagcacgccaccctcgacagcctgcgctggctgctgccgaccggcgaagccatgccgccg
gagctggccagccagtggctgcaacgctacccggctatcgggctggtgaatgcctatggt
ccggctgaatgttccgacgacgtggcgttcttccgcgttgacgcggactccacacgcagc
gcgtacctgccgatcggttcgccgactgacaacaatcgcctgtacctgctcgacgacgcg
ctggaccttgtgccgctgggcgcagtgggcgagttgtgcgtcgccggggccggggtcggt
cgtggttatgtcgcggatccttcgcgtaccgtgccggtgttcgtgccgcatccgttcggt
gcgccgggcgagcgtctgtaccgcaccggcgacctggcgcggcggcgcaaggacggcgtg
ctggagtacgtcggccgggtcgatcatcaggtgaagattcgcggctaccgcatcgagctg
ggcgaaatcgaaacccgtctgctggagcatccggcgatccgtgaatcggtggtgctggac
atcgacggtccgctgggcaaagtgctggcggcgtatctggtgccaagcgctgccacgcag
gatcacgatgcgctgcgagacgcgctgaaaagccacctcaaggccagcttgccggactac
atggtgcctgcgcatctggtgattctggacgcgatgccactgacgccgaacggcaaactc
gaccgcaaggctctgcccgcgccggacgtcagccaggcgcagcaggaatacctcgcgccg
cagaccgaaatggagcaacaactggcgaccatctgggccgatgtgctcaaagtcgagcgg
gtgggcatcactgacaacttcttcgaattgggcgggcattcactgttggccacgcaagtg
gtcacccgtgcgcagaagctgctgcaacgtaacgtgccattgcgggcgatgttcgaattc
aacaccgttcaggcgttggccgagcatcttgaaagccttggcggggcgcaggtcgacgag
cagaaattcgaccgcctggcggacttgatggcggaactggaagggttctga

DBGET integrated database retrieval system