KEGG   Paenibacillus stellifer: PSTEL_14200Help
Entry
PSTEL_14200       CDS       T03335                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
pste  Paenibacillus stellifer
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:pste00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PSTEL_14200
Enzymes [BR:pste01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     PSTEL_14200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2967715..2969778
Genome map
AA seq 687 aa AA seqDB search
MSKSIQLNELTLGVCYYPEHWPEAFWEDDFRRMREMNISVIRMAEFAWAMLEPEEGRFDF
SFFQKVLDLAHNYGLTVIMGTPTATPPAWLTHKYPEVLNANVEGVLYRHGMRRHYNYSSP
VYIELCSRIVRNMAYAYKDHPAVIGWQIDNELNCEMNVFYAEADHTAFREWLKQRYGSLD
RLNQAWGTVFWSQTYTDWEQIYLTRPLVSSSPNPHLALDEKRFISANTISFAKLQADIIR
ELAPQHWITTNGMFGHLDSHELTDQALDFFSYDSYPQFSTIFPGDDEQPLKDRSWSMNLS
IVRSVSPNFCVMEQQSGPGGWVDRIGMGSPRPGQIRLWTYQSVLHGADLLLYFRWRTATF
GTEIYWHGINDYHNRPNRRVKEVAQVGGEFAKIGAAIAGTKYKAEVAILQDYDNIWDGEL
DSWHGALNWQSKLSWFKQLQYRHIPVDLVTLRPGTSLDDLTPYKVIVYPHAAIMTDETAD
LLSRYVEQGGQLFFGARTGYKNLDGHCKMDPFPGPVAGLCGITVEDFTLIKGSVAPAELK
SEVLSLPAGATAAGFNEVLAISDEATEVIAEYASEYYAGSPAFTRRAYGQGHAWYFGAAF
SEQVAGALIEKLGLTSPAADLVTSPAEVELGIRAADGKQYLFALNYSDKPVLVQLNQAAK
DLLSEALMEHEVEMPPYGVLVLEILNS
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaatcgatacagctaaacgaattaacgcttggcgtttgttattatccggagcat
tggccggaggcattctgggaggacgatttccggagaatgcgggagatgaatatctcggtg
atccggatggcggaatttgcctgggcgatgctggaaccggaggagggacggtttgatttc
agtttttttcaaaaagtcctggatttggcgcataactatggattaacagtcattatgggg
actccgaccgctacgccgcccgcttggttgacacataagtatcctgaagttctgaatgcc
aacgtggaaggtgtgttgtacagacacggcatgcggcgtcattacaattacagcagtccg
gtatacatagagttgtgcagccggatcgtgcgaaatatggcctacgcctacaaggatcat
cccgccgtcatcggctggcagattgataacgagctgaactgcgagatgaatgtcttctac
gcagaagcggatcataccgcgttccgggaatggctgaagcagcgttacggttcgctggac
cgcttgaatcaggcgtggggaaccgtgttctggagccagacctataccgattgggagcag
atttatcttacccgtcctctggtcagcagttcgccgaatccgcatctggcgctggatgag
aagcgcttcatatccgcgaatacgatttcgttcgccaagctccaggccgatattatccgc
gagttggcgccgcagcattggattacgacaaacgggatgttcggacatctggacagccat
gaactgaccgaccaggcgctggatttcttctcatacgattcgtatccccagttctcgacg
atctttcccggtgatgacgagcagccgctgaaagaccgatcctggagcatgaatctctcc
atcgtccggtcagtctcgccgaatttctgcgtcatggagcagcagtccggtccgggcggc
tgggtggaccgcatcgggatgggatcaccgagacccggacaaatccggctctggacctat
caatcagttctgcacggagccgatctgctgctgtatttccgctggcgtacggctacgttc
ggcactgaaatctactggcatggcatcaacgactatcacaaccggcccaaccggagggtg
aaggaagtcgcgcaggtaggcggtgagttcgccaaaatcggcgcagcgatagccggaacg
aaatacaaggcggaagtcgccattttgcaggactatgataatatttgggatggagaactg
gattcatggcatggagcgctgaattggcagagcaagctctcatggttcaagcagcttcag
tatcgccatattccggtggatctcgttacgctgcggcccgggacatcgcttgacgacttg
actccttacaaagtgatcgtctatccgcatgcggcaatcatgaccgacgaaacggcagac
cttctaagccggtatgtggagcagggcggacagctcttcttcggagcgcgcaccggttac
aaaaatctggacggccactgcaagatggacccgttcccgggaccggttgccggattatgc
gggatcacggtcgaggatttcaccttaatcaagggcagcgtagctcctgcagagctgaaa
tcggaagttctgtcccttccggcaggcgcaactgcagcaggcttcaacgaggtgctggcc
atttcggatgaagcgacagaagtgatcgccgaatatgcgtccgaatactacgcgggcagc
cccgcatttacacgccgtgcgtatggtcaaggccatgcctggtacttcggcgctgcattc
agcgaacaggtggccggtgctctgatcgagaagctgggtctgacctctcccgccgcagac
ctcgtgacctcacccgctgaggttgagctgggaatccgggcggctgacgggaagcagtat
ctttttgcgctgaattattcggacaagccagttctcgtgcagcttaatcaagcagccaag
gatctgttaagcgaagccctcatggagcatgaggttgagatgccgccgtatggcgtactg
gtcctggaaatactgaactcataa

DBGET integrated database retrieval system