KEGG   Pseudomonas stutzeri 28a24: CH92_20500Help
Entry
CH92_20500        CDS       T03390                                 

Definition
(GenBank) aldose epimerase
  KO
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
pstt  Pseudomonas stutzeri 28a24
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pstt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CH92_20500
Enzymes [BR:pstt01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     CH92_20500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4423415..4424311
Genome map
AA seq 298 aa AA seqDB search
MPVDIQRIEMDQLPCWRIRNGAAELIVAEQGAQVLSYRQGDAPPVIWLSEEAAFERGQAV
RGGVPVCWPWFGDLIRNPQSIQDAYRGSQPAPAHGLVRNIDWLLKDSNTDADGVTLEFAC
NEAGSLPGWPHAVDLKLQIRLDGKGLHLALTSHNRGHAEVALSQALHSYFAISDIHQVSV
EGLDGLPYIETLDAWQQRQQQGDLAFDGETDRIYLELPPTLCLRDPGLNRRITLKTLGSR
SAVLWNPWIAKAQRLSQFADDAWQRMLCIETANVLDDMVRLSPGASHTLGVSIGVEML
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtagacatccagcgcatcgaaatggaccaactgccttgctggcgcatccgcaac
ggtgccgccgaactgatcgtcgccgaacagggcgcgcaggtgctcagctatcgccagggg
gatgcgccgccggtcatctggctcagcgaagaggcagccttcgaacgcggccaggcggtg
cgtggcggggtcccggtttgctggccctggttcggcgacctgatccgcaacccgcagtca
atccaggacgcctaccggggcagccaaccggccccggcgcacgggctggtgcgcaacatc
gactggctgctgaaggactccaacaccgacgccgacggcgtcaccctggaattcgcctgc
aacgaagcgggcagcctgcctggctggcctcacgccgtggacttgaagctgcaaattcgc
ctggacggcaaaggccttcacttggcgctgaccagccacaaccgtggtcatgcagaagtc
gcgctgtcccaggcgctacacagttatttcgccatcagcgacatccatcaggtttcggtg
gaaggcttggacggcctcccctatatcgaaaccctggacgcctggcagcaacgccagcag
cagggcgatctcgccttcgatggcgaaaccgaccgtatctacctggagctgccgccgacc
ctgtgcctgcgtgatccagggctcaaccgccggatcaccttgaagactctcggctcccgc
tcggccgtgctgtggaacccatggattgccaaggcgcagcgcctgtcacagttcgccgat
gatgcctggcagcggatgctctgcatcgagacggcaaacgtgctggacgacatggtccgg
ctgtcccctggcgccagtcacaccttgggcgtctcgatcggcgtcgaaatgctctag

DBGET integrated database retrieval system