KEGG   Pseudomonas stutzeri 19SMN4: UIB01_00760Help
Entry
UIB01_00760       CDS       T03366                                 

Definition
(GenBank) bicarbonate ABC transporter permease
  KO
K15577  
nitrate/nitrite transport system permease protein
Organism
pstu  Pseudomonas stutzeri 19SMN4
Pathway
Nitrogen metabolism
ABC transporters
Module
Nitrate/nitrite transport system
Brite
KEGG Orthology (KO) [BR:pstu00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    UIB01_00760
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    UIB01_00760
Transporters [BR:pstu02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    UIB01_00760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(152793..153662)
Genome map
AA seq 289 aa AA seqDB search
MNANVKLQPASAEPVSIVRPSRLAVLVRRSGRYAVQQLVPPLVILLLLGLIWEMLCSGAD
AALPPPSQVVAETWELIIDPFYDNGGNDVGLAWQLLASLQRVAVGYMLAVVAGVGLGVLI
GQSDWAMRGLDPIFQVLRTVPPLAWLPLSLAGFQDSHPSALFVIFITAIWPIIINTAVGI
RNIPQDYRNVAQVLQLNGFEYFKTIMLPAAAPYIFTGLRIGVGLSWLAIIAAEMLIGGVG
IGFFIWDAWNASRISDIILALVYIGVVGFVLDRLVAFVGQRITRGIPAN
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccaacgtcaaactgcagcccgccagcgccgagccggtatccatcgtccgccct
tcccggctcgccgtactggttcggcgcagcggccgctacgccgtgcagcagctggtgccg
ccgctggtgatcctgctgctgctcggcttgatctgggaaatgctctgctccggtgccgat
gccgcgctgccgccgccctcgcaggtggtcgcggaaacctgggagctgatcatcgatccg
ttctacgacaacggcggcaatgacgtgggcctggcctggcagctgctggcgagcctgcag
cgggttgcggtgggttatatgctggcagtggtcgccggggtcggcctcggcgtgctgatc
ggccagtcggactgggccatgcgcggcctcgacccgatcttccaggtgctacgcaccgtg
ccgccactggcctggctgccgctgtcgctggcgggctttcaggacagccacccctcggcg
ctgttcgtcatcttcatcaccgcgatctggccgatcatcatcaataccgcggtgggcatc
cgcaacatcccgcaggactaccgcaacgtcgcccaggtgctgcagctcaacggtttcgag
tacttcaagaccatcatgctgccggccgccgcgccgtacatcttcaccggcctgcgcatc
ggcgtcggcctgtcgtggctggcgatcatcgccgcggaaatgctcatcggcggcgtcggc
atcggcttcttcatctgggatgcgtggaacgcctcgcgcatcagcgacatcatcctcgcg
ctcgtctacatcggcgtggtcggcttcgtgctcgatcgcctggtggccttcgtcggccag
cgcatcacccgcggcattccggccaactga

DBGET integrated database retrieval system