KEGG   Pseudomonas stutzeri 19SMN4: UIB01_18250Help
Entry
UIB01_18250       CDS       T03366                                 

Gene name
tuf
Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
pstu  Pseudomonas stutzeri 19SMN4
Brite
Translation factors [BR:pstu03012]
 Eukaryotic Type
  Elongation factors
   UIB01_18250 (tuf)
 Prokaryotic Type
   UIB01_18250 (tuf)
Mitochondrial biogenesis [BR:pstu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    UIB01_18250 (tuf)
Exosome [BR:pstu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   UIB01_18250 (tuf)
  Exosomal proteins of breast cancer cells
   UIB01_18250 (tuf)
  Exosomal proteins of colorectal cancer cells
   UIB01_18250 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AHY44308
UniProt: A0A023WX54
LinkDB All DBs
Position
complement(3846874..3848067)
Genome map
AA seq 397 aa AA seqDB search
MAKEKFERNKPHVNVGTIGHVDHGKTTLTAALTRVCSEVFGSARVDFDKIDSAPEEKARG
ITINTAHVEYDSNIRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLSRQVGVPYIVVFLNKADMVDDAELLELVEMEVRDLLSTYDFPGDDTPIIIGSALMALN
GQDDNEMGTTAVKKLVETLDTYIPEPVRAIDKPFLMPIEDVFSISGRGTVVTGRVERGIV
KIQEEIEIVGLRDTTKTTCTGVEMFRKLLDEGRAGENCGVLLRGTKRDDVERGQVLAKPG
TIKPHTKFEAEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGSCELPEGVEMVMPGDNV
KMVVTLIKPIAMEDGLRFAIREGGRTVGAGVVAKIIE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
gtggctaaggaaaaattcgaacgtaacaaaccgcacgtcaacgtcggcaccattggtcac
gtcgaccatggcaagaccactctgacggctgctctgacccgtgtgtgctccgaggttttc
ggttccgctcgtgtcgacttcgacaagatcgatagcgccccggaagagaaggctcgcggt
atcaccatcaacaccgctcacgtagagtacgattccaatattcgtcactacgcgcacgtt
gattgcccgggtcacgctgactatgtgaagaacatgatcaccggtgctgcccagatggac
ggcgcgatcctggtttgctcggctgctgacggccccatgccgcagactcgcgagcacatc
ctgctgtcccgtcaggtaggtgttccgtacattgtcgtgttcctgaacaaggccgacatg
gttgatgacgccgagctgctcgagctggtggaaatggaagtgcgcgatctgctcagcact
tacgacttcccgggcgacgacactccgatcatcatcggttccgcactgatggctctgaac
ggtcaagacgacaacgagatgggcaccactgccgtcaagaagctggtcgagaccctggat
acctacatccctgagccggttcgcgccatcgacaagccgttcctgatgccgatcgaagac
gtattctccatctccggtcgcggcaccgtggttaccggtcgtgtagagcgcggtatcgtc
aagatccaggaagaaatcgagatcgttggtctgcgtgataccactaagaccacctgtacc
ggtgtcgagatgttccgcaagctgctcgacgaaggtcgtgctggtgagaactgtggcgtc
ctgctgcgcggcaccaagcgtgacgacgtagagcgtggtcaggtactggccaagccgggc
accatcaagccgcacaccaagttcgaagcagaagtgtacgtgctgtccaaggaagaaggt
ggtcgtcacaccccgttcttcaagggctaccgtccgcagttctacttccgtaccactgac
gtaaccggttcgtgcgaactgccggaaggcgttgagatggtaatgccgggcgacaacgtg
aaaatggttgttaccctgatcaagccgatcgccatggaagacggcctgcgcttcgcgatt
cgcgaaggtggtcgtaccgttggtgccggcgtggttgccaagatcatcgagtaa

DBGET integrated database retrieval system