KEGG   Pantoea stewartii subsp. stewartii: DSJ_11615Help
Entry
DSJ_11615         CDS       T04970                                 

Definition
(GenBank) 4-aminobutyrate transaminase
  KO
K07250  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
pstw  Pantoea stewartii subsp. stewartii
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pstw00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    DSJ_11615
   00650 Butanoate metabolism
    DSJ_11615
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DSJ_11615
   00280 Valine, leucine and isoleucine degradation
    DSJ_11615
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DSJ_11615
Enzymes [BR:pstw01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     DSJ_11615
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     DSJ_11615
Amino acid related enzymes [BR:pstw01007]
 Aminotransferase (transaminase)
  Class III
   DSJ_11615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2342992..2344305
Genome map
AA seq 437 aa AA seqDB search
MQNVLAEQQTYSDNSLLLDVREHHVPRGIVTAHPLVIERAKGSEVWDVEGNRYLDFVGGI
GVLNVGHNHPAVVNAVTRQLGLVSHACFQVVAYPGYIELAQRLNKLVGGEDHYKSVFFTS
GAEAVENAVKIARAYTQRSGIIAFDGAFHGRTLLGVTLTGMSAPYKQNFGSFPSDVYRLP
FPNPLHGVTEADCLKALEQLFAVQILPERVAAIIIEPVQGDGGFLPAGPAFMQALRRITT
QHGIVLICDEIQSGFGRTGTMFAFQQLGIKPDLVTTAKSLAGGLPISGVVGKAEIMDSPA
PGGLGGTYGGNALACAAALAVLDIFEQENLLARSCQLGEQLNQRLRQLADKYACIGDVRG
VGFMQAVEILDVDTHKPDSALTQKILDCACQEGLLLIKCGLHRNTIRFLAPLVTTDSQLE
EALHIFDIALARATGRL
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgcagaatgtcctggcagaacagcaaacttattcggataacagcctgttgctggatgtc
cgagaacatcatgtgccgcgtggcatcgttaccgcacatccgctggtgatcgaacgcgcg
aaaggcagcgaagtatgggatgtggaagggaaccgctatttggatttcgtgggcggcatc
ggcgtactgaacgtcggtcataaccatcctgcggtcgttaatgccgtgacccgtcagctc
ggcctggtgtcgcatgcctgttttcaggttgtggcctatcccggctatatcgaactggca
cagcgcctgaataagctggtcggcggtgaagatcattataaaagtgttttcttcaccagc
ggcgcagaagccgtcgagaatgccgtaaaaattgcgcgagcttatacgcaacgttccggc
attatcgcttttgacggtgccttccacggtcgtaccttgctgggcgtcacgctgaccggc
atgtctgcgccgtacaaacagaatttcggttcgttcccgagtgatgtgtatcgtctgccg
ttcccgaatccgttgcacggtgtcacggaggccgactgtctgaaggcgctggagcagctg
tttgcggtgcagattctgccggagcgcgtggccgccattatcattgaaccggtgcagggc
gatggcggcttcttaccggccggtcctgcgtttatgcaggccctgcgccgcattaccacc
cagcacggcattgtgttgatctgtgatgaaatccagagcggctttggccgtaccggcacc
atgtttgccttccagcaacttggcatcaaaccggatttggtcacgacggcgaagagtctg
gcaggcgggttgccgatttcgggcgtggtaggtaaagccgagatcatggacagcccggcg
ccgggcggactgggcgggacctatggcggtaacgcgctggcctgtgcggcggccctcgcg
gtactggatatctttgagcaggaaaatctgctggcgcgttcttgtcagttaggtgagcaa
ctgaatcagcgtctgcgtcagctggcagacaagtatgcctgtattggcgatgtgcgcggc
gtaggttttatgcaggccgttgagattctggatgtggacacacacaaacccgacagtgca
ctgacgcaaaagatcctcgactgcgcctgtcaggaagggttgctgctgattaaatgtggc
ttgcatcgcaataccatacgtttccttgcaccgttagtgaccaccgattcgcaacttgaa
gaggcgctgcatattttcgatatcgcgctggcgcgggcgaccggtcgtttgtaa

DBGET integrated database retrieval system