KEGG   Pedobacter steynii: BFS30_10795Help
Entry
BFS30_10795       CDS       T04469                                 

Definition
(GenBank) pyruvate dehydrogenase
  KO
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
psty  Pedobacter steynii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:psty00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BFS30_10795
   00020 Citrate cycle (TCA cycle)
    BFS30_10795
   00620 Pyruvate metabolism
    BFS30_10795
Enzymes [BR:psty01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BFS30_10795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2606038..2607690
Genome map
AA seq 550 aa AA seqDB search
MAEIVRMPKMSDTMTEGVMAKWHKKVGDKVKSGDVMAEVETDKATMDLESYWDGTVLYIG
VEEGKAVPVDAVIAVIGKEGEDYKAALDAEGAAAPSAEAKPATDAAPAEKPAEDKKETPA
GITDADLEKMGVTVVRMPLLSDTMTEGVIAEWHKKVGDKIKNDDILADVETDKATMEVMG
YADGTLLHIGVEKGAAAKVNGIIAIVGPEGTDISGILAQGDAPAKPAADKKADAPVAESA
PSVTAEAATEGSDRVKASPLAKRIAKDKGIDLAQVAGSADGGRIIKKDIENFKPAAAAPA
PAETTSAAPAEKQAQVSIPQFIGEEKYTEKPVTQMRKVIAKRLSESLFTAPHFYLTMAID
MDGAIAARTKINEYAPVKISFNDMVLKAVAIALKQHPNVNSSWLGDKIRYNEHVNIGVAV
AVEDGLLVPVVRFADGKSLSHISAEVKDFAQRAKAKKLQPADWEGSTFTISNLGMFGIDE
FTAIINPPDACILAIGGISQVPVVKNGAVVPGNVMKVTLSCDHRVVDGATGSAFLQTLKA
LLEEPVRLLV
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaatagttagaatgcccaaaatgagcgacaccatgactgaaggtgtgatggcg
aagtggcataaaaaagttggcgataaagttaaaagtggcgatgtaatggccgaagtggaa
accgataaggcaaccatggatttagagtcatattgggatggtaccgttttgtacattggt
gtagaagaaggtaaagctgttcctgttgatgcggtgattgctgtcataggtaaagaaggc
gaagattataaagcagcgttggatgctgaaggtgctgcggccccatcagctgaagcgaag
ccggcaacggatgccgctcctgcagaaaaacctgctgaagataaaaaagaaacacctgct
ggtattacggatgcggatttagaaaaaatgggtgttactgtagtaagaatgcctttgcta
agtgatacgatgactgaaggcgtgatcgctgagtggcataaaaaagttggtgacaaaatt
aagaacgatgatattcttgccgatgtggaaaccgataaggcgactatggaggttatggga
tacgcagacggaactttattacatattggtgttgaaaaaggtgcagcagctaaagtgaac
ggaattatcgcgattgttggtcctgaagggactgatatcagtggtattcttgcgcaaggc
gatgctccggcaaaacctgcagcagataaaaaagcagatgctccggtagcagaaagcgct
ccgtctgtaacagcagaagccgcgactgaaggttcagatcgcgtaaaagcatctcctctg
gcaaagagaattgcgaaagacaaaggtattgaccttgctcaggtagcaggcagtgctgat
ggcggacgtatcatcaaaaaagacattgaaaacttcaagccagctgcagcagcgcctgca
ccggcagagacaacttctgcagctcctgcagaaaaacaagctcaggtaagtattcctcag
tttatcggcgaagagaaatatacagagaaaccggttactcagatgcgtaaagtaattgct
aaacgtttatctgaaagcctatttacagcgccgcatttctatttaacaatggctattgat
atggatggtgcaattgctgcacgtactaagatcaatgaatatgcgcctgttaaaatctct
ttcaatgatatggtcttaaaagcagttgcgattgctttaaaacaacatcctaatgttaac
tcttcgtggttgggcgataaaatccgttacaatgagcatgtaaacattggtgtagcagta
gctgttgaagatggtctattggttcctgtagttcgttttgcagacggtaaatcactatct
catatctctgcggaagtaaaagattttgcacaacgtgctaaagcgaaaaaattacaacct
gctgattgggaaggttcgactttcactatctctaacttaggaatgtttggaattgatgaa
tttacagcgatcattaacccacctgatgcctgtatccttgcaattggaggaatctctcag
gttccagtggttaaaaacggtgcagtagttccagggaatgtcatgaaagtaaccttaagt
tgtgatcaccgcgtggtggatggtgcaacaggatctgctttcttacagacactaaaagca
ttgttagaagaaccagtaaggttattggtttaa

DBGET integrated database retrieval system