KEGG   Pedobacter steynii: BFS30_25195Help
Entry
BFS30_25195       CDS       T04469                                 

Definition
(GenBank) hypothetical protein
Organism
psty  Pedobacter steynii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(6101029..6107502)
Genome map
AA seq 2157 aa AA seqDB search
MQFNTLADILKRRSDQDKSGITFISGTNQEEFLSYKALFHHATKALAVLQNAGLEKGDEL
MFQVDDMKTFVISFWACILGGVIPVPLSTDNSYDHRNKLFNIWPVLKSPFLLIEDNDFVK
IKNFAESNGVVETYLEMADRIIHPRTLSLSDENGRIENIQAEDTAFIQFSSGSTGSPKGV
ILSHRNLLYNVDAIATASGYSKQDSLLSWMPLTHDMGLIGFHISPLYSGLNHFIIPTSLF
IRRPSLWLDAISNHRVTVTCSPNFGYEYTLKRLNSDENQNWDFSAIRLIYNGAEPVSEKI
SRRFLAQFENYGLSSLAICPVYGLAEASLAVSISRIEDPVLSLKISRRKNNIGEKVLILT
AGNEGVSIVNLGTAVPNCAISILDRQAKQLPDETIGLVYIKGESVTSGYYNNTEQTNKTI
SSDGWLNTGDLGFLKDGCLFITGRDKDVFFVNGQNYYPNDLEGIAGELGEIELNKIAIAG
AYNHDIEQEEVIAFVVHKGSLHNFLKTSGILRNYLNAKTGISLKSVIPVKNIPRTTSGKI
QRFKLLEAYQNNEFQSVVAEIEEIEKQAASAVDLMLEQLSPIEKQVFEIWQQVLPGRKPD
PAYSFFENGGNSLKVTEMQMSILKKWNIDLSIRLLYEEPTLAGIAKNIRSGPVKNYQPVK
GNTYRINQPVGALQRRLYYHWALTPESINYNIPVAMFLEGLPDFSLLADQLRALVLRHDS
LRTTFVFDQEPKFVVHHELDVQLEILKMGEKAGEFNMALHVQPFNLETGPLFRFKIFSIR
PDLHILFLDFHHIIADGISVHLFLQELLRLYQGKALPSSGIQYADFLNWEAEKLKGNEIA
VQKKYWQEKIAEEWPVLELPADHSRPVYFDGKGERIFFQIETGERKKIALLAQKQGCSIH
VLLFTIYKILLFKYTGQHNMVIGIPVAVRDHPDLQSLFGMFVNNLAVKQELDGGATFIEV
LKSEAENMNEALLNKDFPFDELVEMYKGPRDPARNPLFDTMFVFQNMLDVFPSSDDFSTK
PCFFDPGTTKFDISMEIFDDGDTFNGNIEFSKSLFERERILVMVSHFKQLMETILNDPEK
RICDLSYLSHQEHFYQLDTFNDTTAIYPDKKTIQQLIREQAIKTPDHLALIFGNKQVTYQ
ELEIQSDHLARNLQKAGVKAGGIVAIYLKRSPELIYSILAVLKSGATYLPIDFELPPGRI
ELILNDSRCDFIISSSSSVSGLKSLTDARKITARVIDVDDSDLAENPAGHFSGNKKPADI
AYIIYTSGTTGSPKGVMISQQSLVNYSVWAAKTYTSSAKEAFPFFTSVSFDLTITSIFVP
LITGNTIVIYEEHEMAIETILRENKVSTIKLTPSHLKIVARLPLMHSLSGSKIKRFIVGG
EKLERWLAQEIYTLFHGKVEILNEYGPTEATVGCMIHAFDPKDQSAVVSIGKPADNMQIY
VLDQYLSMVPIGVTGEIYIAGDGLATGYLFNEQATVKSFINHPFAEGKRMYKSGDKAKFL
PDGTIEYIGRFDDQVKINGYRIELAEIELNLRQYPGIIEALLQVKINKHQVPVILAYYTS
DTVIDPDDLISALSERLPHYMLPAEYFRIPKIPLTKNQKIDYSSLPVEHPSAPSIKKDKP
QGKIQMIIEGVWKEILEYEGAGADINFFELGGDSIKAAQISSRLLAKGVRVSARDILTWH
TLERVSAHAKEIDISLATHQGPVEGSIQPSPIAAWFFHQKFKHAGFYNQTLLFEFLRTPD
TALLDKAFTMLLQHHDGLRLNYDAGRNEFFYNPLHQKATFKVQTFSEIFSGGPEELVGFY
AAEAWNQFNLEKDCLLRGALFNSNDRHFLFIRAHHLVIDGMSWRILLEDLYQVYTALESG
RIPVLPLKTDSLTAWQNDRLQICNSASFLGYVAKWEEIDRARENTLGTDQPKKQSVGRPF
KVHSLAASIDMSFLLRTASHIFKFDPALLLYAAFLESMQQMKGKDTFLVTHESHGRHTRD
FNFSRTIGWFTAMYPGLWEWKGKDLLTKIHYLKEQMEAYNDACAYYGIWKYGCHKQDDLV
NDIPDFRFNYLGEFGSELSNDLFQYSMESPLLETHHENHCTAGVDINAMVVGKKLWLEIS
YSHESVFAGAGELLLRSWTENLEKIITTLKNTTSFTQPEEFMSVDLDENEMDRLFNS
NT seq 6474 nt NT seq  +upstreamnt  +downstreamnt
atgcaatttaatacgcttgcagatattttaaaacggagatctgatcaggataaatctgga
attacttttataagcggtaccaatcaggaagagtttctttcttataaggcgctgttccat
catgctacgaaagctttggctgttttgcaaaatgcaggattggaaaaaggggatgaactg
atgtttcaggtcgatgacatgaaaacttttgtcatttcattctgggcctgtatacttggc
ggagtgattcctgtacctctttcgacggacaatagttatgaccacaggaataagctgttc
aatatctggcctgtattgaaatctccatttttattgatagaagataatgactttgtcaaa
atcaaaaattttgctgaaagcaacggagtggtggaaacctatctggagatggctgaccgg
attatccatccccggactttatccctttctgatgaaaacggacggattgaaaatattcag
gccgaggataccgcttttatccagttttcttccggttctaccggatcaccgaaaggagtg
atcctcagtcatcggaacctgctttacaacgtggatgcaatcgctactgcatctggttat
tcaaagcaggattctttgctcagctggatgcctttaacgcatgatatggggcttatcggc
tttcatatcagcccgctttatagtggccttaatcattttatcattccaacctcactgttt
atcaggaggccgtcattatggctggatgcgataagcaatcatcgtgtgacagttacctgc
tctccaaattttggttatgagtataccctaaaacgtttaaactcagatgaaaaccaaaat
tgggacttcagcgcaattcgtctgatctacaatggcgcggaaccggtctctgaaaaaatc
agtcgccgttttctggcccagtttgaaaattatggcttaagcagtctggccatttgtccg
gtttatggtctggcggaagcaagcctggccgtttcgatttccagaattgaagatcctgta
ctgtcgttaaaaatcagtcgccgaaaaaataatataggtgaaaaagttttaatcctgacc
gcaggtaatgaaggcgtatctatcgtaaatttaggtactgcagttcccaattgtgccatt
agcatattggacagacaagcaaagcaactgccggacgaaaccatagggctggtttatatc
aagggtgaatctgtgaccagcggttattacaacaataccgagcagaccaataaaaccatc
agcagtgatggctggttaaatacaggagaccttggttttctgaaagacggctgcctgttc
atcacaggcagggacaaagatgttttttttgtaaatggtcagaattattatccgaatgac
ctggaaggtatagcgggagaactcggggaaattgaattgaataagattgcaatagccggg
gcttataaccatgatatcgaacaggaggaagtgattgctttcgtagttcataaaggcagt
ctgcataattttctgaaaacttccggaatattgaggaattacctcaatgcaaaaacgggt
atttcattgaaatccgttataccggttaaaaatataccgaggacaaccagtggtaaaatc
cagcgctttaagctgttggaagcataccagaacaatgagtttcaaagtgttgttgctgaa
atagaggagatcgaaaagcaagctgcatcagcggtagatttaatgttggagcagcttagt
ccgatagaaaagcaggtttttgaaatctggcagcaggtactaccgggccggaagccggat
cccgcttacagtttctttgagaatggaggaaattccctcaaagtaacggaaatgcaaatg
agcattttgaagaagtggaatattgatctgagcattcgcctgttgtatgaagagcccaca
ttagccggtattgctaaaaatattaggtccgggcctgttaaaaattatcagccggttaaa
ggaaacacttaccggatcaatcagccggttggggctttacaacggaggctttactatcac
tgggcattgacaccggaatccataaattataatattcctgtggccatgtttctcgaaggc
ctgcccgatttttcccttttagcagatcagttaagagcgcttgttttgcgccacgacagt
cttcggaccacttttgtttttgatcaagaaccaaagttcgtggttcatcatgagctggat
gttcagctggaaatcctgaagatgggggagaaagccggggaattcaatatggctttacac
gttcagccatttaacctggaaacaggtccgctttttaggtttaagatattttcaataaga
cctgatcttcatattttattccttgattttcatcatattatagctgatggcatttctgta
cacctctttttacaggaattactgaggttgtatcagggaaaagccctgccttcttccgga
attcaatatgctgatttcttaaactgggaagctgaaaaattaaaagggaatgaaattgca
gttcaaaagaaatactggcaggaaaagatagcagaggaatggccggtattagaattgcct
gcagaccatagccgtcccgtttattttgatggaaagggagaaaggatattttttcagatt
gaaacgggagaaagaaaaaaaatagctttactggcgcagaaacagggctgtagtatacat
gtactgttgttcactatttataaaattttattgtttaaatataccggtcaacataatatg
gtaatcggtattcctgttgcggtacgcgatcatcctgacctgcaatcgctgtttggaatg
tttgtgaacaatctggcggtaaaacaggagttagatggcggggctacttttattgaagtg
ctgaaatcggaggcggaaaacatgaacgaagctttattgaataaagattttccgtttgat
gaattggttgaaatgtataaaggcccgagagatcccgcaaggaacccgctctttgatacg
atgtttgtttttcaaaacatgctggatgttttcccttcttctgatgatttcagtaccaaa
ccctgtttctttgatccggggactaccaagtttgatatttccatggaaatatttgatgac
ggagatacctttaacggcaatattgagtttagcaaaagcctgttcgaacgggagcgcatt
ttggtaatggttagccattttaagcaactgatggagaccatactgaacgatcccgaaaag
aggatctgtgacctatcttatctaagtcatcaggaacatttttatcaattggataccttt
aatgataccacagcgatttatcccgataaaaaaacgattcaacagttaatcagagaacag
gcgataaaaacgcctgatcatttggctttaatatttgggaataagcaggttacttatcag
gaactggaaatccaatccgatcatctggcccgaaatctgcagaaagcaggcgttaaagcg
gggggaatcgtcgcaatttacctgaaaaggtcgccggaactgatttatagtatactggct
gttttaaagtccggggcaacttatcttccaattgatttcgaattgcctcctggcagaatt
gaactgatattaaatgatagccgatgtgatttcatcatcagcagttcatcctctgtctca
ggtttaaaatcgttgacagatgcccgtaaaataacagcaagggtgattgatgtggatgat
tctgatcttgcggaaaacccggcaggtcatttttccggaaataaaaaaccggccgatatc
gcttatatcatttatacttcaggaacaaccggatctcccaaaggagtcatgatcagtcag
caatctctggtgaattatagtgtgtgggcggctaaaacctatacctcttcagcaaaggaa
gcattcccattttttacttcagtctcttttgacctgaccatcacctctatttttgttcct
ctgattacgggcaatacgattgttatttatgaagaacatgaaatggcaattgaaaccatc
ctgcgtgagaataaggtttccacgataaaactgacaccttcccatcttaaaatcgtggcc
cggctcccgctgatgcattccctttccgggagtaaaataaaaagatttattgtgggaggg
gaaaaactggaacgctggctggctcaggagatttacactttatttcatggtaaagtagaa
attttaaatgaatatgggcctacagaggccacagtaggttgcatgattcatgcctttgac
ccgaaagatcagtcggcagtagtttccattggaaaaccagccgataatatgcagatatat
gtattggatcaatacctgtctatggtcccaatcggggtaacaggagagatctatattgcg
ggagatggtttggctaccggttatttgtttaatgagcaggccactgtaaaaagttttatt
aaccatccgtttgcggaagggaaaaggatgtataaatccggtgataaggcgaaatttctc
ccggatggaaccatagaatatatcggaagatttgatgatcaggtcaaaataaacggatac
cggattgaacttgcagagattgaactgaatttaaggcaatatcctggcattattgaagct
ttattacaggtgaaaataaacaaacatcaggttcctgttattttggcttattataccagt
gacaccgttattgatcctgatgaccttattagtgcattatccgaaagactgcctcattac
atgctgccggcggaatacttcaggataccaaaaataccgctgacaaaaaatcaaaaaatt
gattacagtagcctgccggttgaacatccttcggctccttcaatcaaaaaggacaagcca
caagggaaaattcaaatgatcatcgaaggggtatggaaagagattctggaatatgaaggg
gcaggtgccgacattaacttttttgagttgggtggggattctatcaaggcagcacagatt
tcatcccgtttattggcaaaaggagtccgtgtatctgccagagatatcctgacctggcac
actttggaaagagtcagtgcccatgcaaaagaaatcgacatcagccttgcgactcatcag
ggaccggtagaggggagcatacaaccatcaccaattgctgcctggtttttccaccaaaag
tttaaacatgccgggttttataaccagactttgcttttcgagtttttaaggacaccggat
accgcgctgctggacaaagcatttacgatgttgctgcagcaccatgatgggctcagactc
aattatgatgctggcaggaatgaatttttttataatcctttgcatcagaaagcaaccttt
aaagttcaaaccttcagtgaaatattttccggaggaccggaagaactggttgggttttat
gccgctgaggcatggaatcagtttaatctggaaaaggattgtctgctgaggggagcctta
tttaattccaatgacaggcattttttattcatcagggcacatcacctggttattgacggg
atgtcctggagaattttgctggaagatttatatcaggtttatacagcattggaaagcggc
agaattccagttttacctttaaaaacggattcgctgactgcctggcaaaatgatcgtttg
cagatttgcaattcggcttcttttctgggctatgtggcgaaatgggaagagattgatcgt
gcccgggaaaatacgctgggcacagatcagcccaaaaagcaaagtgttggccgtcctttt
aaagtacattctctagccgcatcaatcgatatgagcttcttgctgagaacggcttcgcat
attttcaaattcgatcctgcattgttgttatatgcggcatttttagagagtatgcagcag
atgaaaggtaaggatacctttctggttacacatgaaagccatggtcgtcataccagagat
ttcaatttttcaagaaccataggctggttcacggcaatgtacccgggtttatgggaatgg
aaaggaaaggacctgctcactaaaatacactatctgaaagaacagatggaggcttataat
gatgcctgtgcctattatggcatttggaagtatggctgccataaacaggatgatttagta
aatgacattccggatttcagatttaattatctgggcgagtttggttcagaattaagtaac
gacctttttcaatatagtatggagtcgcctcttttagagacacaccatgaaaatcattgt
acagcgggtgtcgacatcaatgcaatggtagttggcaaaaaactgtggctggaaatcagt
tatagtcatgaatctgtttttgcaggcgcaggggagttgctgcttcgttcctggacagaa
aatctggagaaaatcatcaccacattaaaaaacaccacttcttttacgcagcctgaagag
tttatgtccgttgatctggatgagaacgaaatggacaggttgtttaatagttaa

DBGET integrated database retrieval system