KEGG   Pseudarthrobacter sulfonivorans: AU252_12555Help
Entry
AU252_12555       CDS       T04210                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
psul  Pseudarthrobacter sulfonivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: ALV41888
UniProt: A0A0U3P949
LinkDB All DBs
Position
complement(2786342..2787835)
Genome map
AA seq 497 aa AA seqDB search
MTDVLTQRGAPVNIRHADRLYINGEWILPTSKSGFDIIDAGTEETFFRVAEAGPHDMDAA
ITAARYAFDHSPWPFLEPQVRGEYLRKLGAGLRARSSETGTFWSRQAGVLFSMSQMAITR
VSNTLDYHADLAATYPFEALATPEFAPFGVVVKEPIGVVGAIVPWNTPLSLAIHKLAPAL
LAGCTVVLKAPPEAPGELYVLAEIAEEIGLPAGVLNVVTADREVSEQLVRDPRVDKISFT
GSSGVGRRIASLAGERMARYTLELGGKSAAVIFDDYDIETAAKTLSAAECSLNGQVCMSL
TRVIVTKSRHDEMAEALGSIFGSVRVGDPFEADSQLGPLALGRQQERVLGYIQKGIDEGA
NLVTGGRRPAHLERGFYVEPTVFANVDNNSTIAQEEIFGPVLSVIAADNEEHAIELANGT
VYGLNSAVFTNDNDRAYHAARRLRSGTVGHNGFKTDQLMGVGGFKQSGVGREGGLQGLLP
YLESKTVLLDGAPSRFQ
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgtactcacccagcgcggcgccccggtcaacatccggcatgccgatcgcctc
tacatcaacggcgagtggattcttcccacgagcaaatccggcttcgacatcatcgatgcc
ggcaccgaagagactttcttccgcgtcgccgaggccgggccccatgacatggacgcggcg
atcaccgccgcccgatatgcgttcgaccactcgccatggccgttcctcgaaccgcaggtg
cgtggtgagtacctccgcaaactcggggcgggactgcgcgcgcgttcgtcggagaccggg
acgttctggtcgcggcaggccggcgtgctgttctccatgtcgcagatggcaatcacccgc
gtatcgaacaccctcgactaccacgcagacctcgcagcgacctatccgttcgaagccctg
gcgacaccggagttcgccccgttcggcgtcgtagtgaaggaaccgatcggcgtcgtcggc
gcgatcgtgccttggaacacgccgctgtcgctcgcgatccacaagctggccccggccctt
ctcgccggctgcaccgttgtcctgaaggcacctcctgaggcacctggcgagttgtacgtg
cttgcagagatcgccgaagaaatcggcctcccagccggcgtgctcaacgtcgtgactgcc
gaccgcgaagtttctgagcagctcgtgcgagacccgcgcgtcgacaaaatttcgtttacg
gggtccagcggcgtgggacggcggatcgcctcgttggccggcgagcggatggcccggtac
accctggagctcggcggaaagtccgcggcggtcatcttcgacgactatgacatcgaaacc
gccgccaagaccctttccgccgcggaatgctcgctcaatggccaggtgtgcatgtcgctg
acccgcgtgatcgtcacgaagtcgcgccacgacgagatggcggaagcactcggatccatc
ttcggctcggtgcgggtcggagacccgttcgaagccgacagccagcttggcccgctggcg
ctgggacgccagcaagagcgagtgctgggctatatccagaagggcatcgacgagggcgcg
aacctggtcaccggcggccgccgtcctgcgcacctcgagcgtgggttctacgttgagccg
accgtcttcgcgaatgttgacaacaactcaacgatcgcccaggaggagatcttcggcccg
gtcctatcggtcatcgctgccgacaacgaagagcacgcgattgagctcgcgaacgggacc
gtctacggactgaactcggccgtgttcaccaacgacaatgaccgggcgtatcacgcggcc
cgccggcttcgttcgggaacggttggccacaacggcttcaagacggaccaactgatgggc
gtcggggggttcaagcagtccggtgtgggccgcgaaggcggcttgcagggccttctcccc
tacctggaatcgaagacggtactgctcgacggcgccccctcacgtttccagtga

DBGET integrated database retrieval system